KEGG   Homo sapiens (human): 1018Help
Entry
1018              CDS       T01001                                 

Gene name
CDK3
Definition
(RefSeq) cyclin-dependent kinase 3 (EC:2.7.11.22)
  KO
K02088  
cyclin-dependent kinase 3 [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     1018 (CDK3)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   1018 (CDK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q25.1
AA seq 305 aa AA seqDB search
MDMFQKVEKIGEGTYGVVYKAKNRETGQLVALKKIRLDLEMEGVPSTAIREISLLKELKH
PNIVRLLDVVHNERKLYLVFEFLSQDLKKYMDSTPGSELPLHLIKSYLFQLLQGVSFCHS
HRVIHRDLKPQNLLINELGAIKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGSKFY
TTAVDIWSIGCIFAEMVTRKALFPGDSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSF
PKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVL
QRFRH
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggatatgttccagaaggtagagaagatcggagagggcacctatggggtggtgtacaag
gccaagaacagggagacagggcagctggtggccctgaagaagatcagactggatttggag
atggagggggtcccaagcactgccatcagggagatctcgctgctcaaggaactgaagcac
cccaacatcgtccgactgctggacgtggtgcacaacgagaggaagctctatctggtgttt
gagttcctcagccaggacctgaagaagtacatggactccaccccaggctcagagctcccc
ctgcacctcatcaagagctacctcttccagctgctgcagggggtgagtttctgccactca
catcgggtcatccaccgagacctgaagccccagaacctgctcatcaatgagttgggtgcc
atcaagctggctgacttcggcctggctcgcgccttcggggtgcccctgcgcacctacacc
catgaggtggtgacactgtggtatcgcgcccccgagattctcttgggcagcaagttctat
accacagctgtggatatctggagcattggttgcatctttgcagagatggtgactcgaaaa
gccctgtttcctggtgactctgagattgaccagctctttcgtatctttcgtatgctgggg
acacccagcgaagacacatggcccggggtcacccagctgcctgactataagggcagcttc
cctaagtggaccaggaagggactggaagagattgtgcccaatctggagccagagggcagg
gacctgctcatgcaactcctgcagtatgaccccagccagcggatcacagccaagactgcc
ctggcccacccgtacttctcatcccctgagccctccccagctgcccgccagtatgtgctg
cagcgattccgccattga

DBGET integrated database retrieval system