KEGG   Homo sapiens (human): 101929601Help
Entry
101929601         CDS       T01001                                 

Definition
(RefSeq) putative exonuclease GOR
  KO
K14570  
RNA exonuclease 1 [EC:3.1.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    101929601
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     101929601
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    101929601
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
8q21.2
AA seq 675 aa AA seqDB search
MLRATAPCWFPPGYPEAKKVAEEAALEASRHLGGEQSQAGAPEGSKMLRATAPCWFRPGY
PEAKKVAKEAAPEASRHLGAEQSPAGAPEGSKMLRATAPCWFPPGYPEAKKVAEEAALEA
PEFPLPSHQPAQSFGLWVPQMHKQASAFVDIQAEPQNRGPAVPPAWPKMVTESCYFPAQR
GSACRLPAAPRLTERPSGVRISAPRKRKTIAHSSSPCLVTGYTDAKRTRVASSSQRSRGS
KVGRQPGKTRNRSGMACKTTATTSSKRIVRRASLPSLSLKKPIILRSSGCQVPTVLRRGY
LQLFTEECLKFCASKQEAEEKALNEEKVAYDCSPNKNRYLNVVLNTLKRLKGLTPSSMPG
LSRAALYSRLQEFLLTQDQLKENGYPFPHPERPGGAVLFTGQGKGPGDSSCRVCCRCGTE
YLVSSSGRCVRDQLCYYHWGRVRSSQVAGGRVSQYTCCAAAPGSVGCQVAKQHVRDGRKE
SLDGFVETFKKELSRDAYPGIYALDCEMCYTTHGLELTRVTVVDADMRVVYDTFVKPDNE
IVDYNTRFSGVTEADVAKTSITLPQVQAILLSFFSAQTILIGHSLESDLLALKLIHSTVV
DTAVLFPHYLGFPYKRSLRNLAADYLAQIIQDSQDGHNSSEDANACLQLVMWKVRQRAQI
QPRHRSASPAALACP
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgagccacagctccctgctggttcccccctggatacccagaagctaagaaggtg
gccgaggaggcggccctggaggcaagccgccatttgggaggggagcagagccaggccggt
gctcccgaaggcagcaagatgttgcgagccacagctccctgctggttccgccctggatac
ccagaagctaagaaggtggccaaggaggcggccccggaggcaagccgccatttgggagcg
gagcagagcccggccggtgctcccgaaggcagcaagatgttgcgagccacagctccctgc
tggttcccacctggatacccagaagctaagaaggtggccgaggaggcggccctcgaggct
ccagaattcccactgccctctcatcagcctgcccagagcttcgggctctgggtgccccag
atgcacaagcaggcctcagcatttgtggacatccaggcggagccccagaacaggggtccg
gcggtgcccccagcgtggcccaagatggtgacggagtcgtgctacttccctgcgcagagg
ggatcggcctgccgcttgccagccgccccaaggctgacagagaggccctcgggagtccgc
atctcagcccccaggaagaggaagacgatcgcccactcttccagcccttgcttggtcaca
ggttacacagatgccaagagaacccgggtggccagcagcagccaacgctcccgtggctcc
aaggtcggcagacagccagggaagacgcgcaacaggtcagggatggcatgcaagaccacc
gccaccaccagctctaagcgaatcgtccgtcgtgcatccttaccgagtttgagtttgaag
aaacccattatcctccgaagctctgggtgccaagtccccaccgtcctccgccgaggctat
ctccagctgttcaccgaagagtgtctcaagttctgcgcctccaagcaggaggccgaggag
aaggcgctgaacgaggagaaggtggcctacgactgcagccccaacaagaacaggtacctg
aacgtggtcctgaacaccctcaagagactgaagggcctgacccccagctccatgcccggc
ctcagcagggccgccctgtacagccgcctccaggagttcctgctcacccaggaccagctc
aaggagaacggctaccccttcccgcaccccgagcggcccggaggcgccgtcctcttcact
ggccaggggaaggggcccggcgactcctcctgcagggtctgctgccgttgtggcaccgag
tacctggtgtcctcctcgggccgctgtgtacgcgaccagttgtgttattatcactggggg
cgggtccgctcgagccaggtggctggaggccgggttagccagtacacctgctgtgcagct
gctcctggctctgtgggctgccaggtggcaaagcagcacgtgcgggacggccgcaaggag
agcctcgatggcttcgtggagaccttcaagaaagagttgtccagagacgcttatccagga
atctacgccttggactgtgagatgtgctacaccacgcatggcctagagctgacccgcgtc
accgtggtggacgccgacatgcgagtggtgtacgacaccttcgtcaagcccgacaacgag
atcgtggactacaacaccaggttttccggagtcaccgaggccgacgtcgccaagacgagc
atcacgttgccccaagtccaagccatcctgctgagctttttcagcgcccaaaccatcctc
atcgggcacagcctggagagcgacctgctggccctgaagctcatccacagcaccgtggtg
gacacggccgtgctcttcccgcactacctgggtttcccctacaagcgctccctcaggaat
ctcgcggccgactacctggcacagatcatccaggacagccaggacggccacaactccagc
gaggacgcaaacgcctgcctgcagctggtgatgtggaaggtccgacagcgcgcccagatc
cagccacgccaccggtccgcctctcccgccgccctggcctgtccttag

DBGET integrated database retrieval system