KEGG   Homo sapiens (human): 10193Help
Entry
10193             CDS       T01001                                 

Gene name
RNF41, FLRF, NRDP1, SBBI03
Definition
(RefSeq) ring finger protein 41
  KO
K11981  E3 ubiquitin-protein ligase NRDP1 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    10193 (RNF41)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     10193 (RNF41)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    10193 (RNF41)
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    10193 (RNF41)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    10193 (RNF41)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    10193 (RNF41)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: USP8_interact zf-C3HC4_2 zf-C3HC4 zf-RING_2 Sina zf-C3HC4_4 zf-RING_6 zf-rbx1 zf-Nse zf-C3HC4_3 zf-RING_UBOX zf-RING_5 U-box zf-ANAPC11 Trimer_CC zf-RING_10 Zn_ribbon_17 BLOC1_2 zf-TRAF DUF641 PI3K_P85_iSH2 SlyX Prok-RING_4 zf-TRAF_2 IncA
Motif
Other DBs
NCBI-GeneID: 10193
NCBI-ProteinID: NP_001229755
HGNC: 18401
Ensembl: ENSG00000181852
Vega: OTTHUMG00000170328
Pharos: Q9H4P4(Tbio)
UniProt: Q9H4P4 A0A024RB33
Structure
PDB: 

Jmol
Position
12q13.3
AA seq 317 aa AA seqDB search
MGYDVTRFQGDVDEDLICPICSGVLEEPVQAPHCEHAFCNACITQWFSQQQTCPVDRSVV
TVAHLRPVPRIMRNMLSKLQIACDNAVFGCSAVVRLDNLMSHLSDCEHNPKRPVTCEQGC
GLEMPKDELPNHNCIKHLRSVVQQQQTRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAI
RSVNPNLQNLEETIEYNEILEWVNSLQPARVTRWGGMISTPDAVLQAVIKRSLVESGCPA
SIVNELIENAHERSWPQGLATLETRQMNRRYYENYVAKRIPGKQAVVVMACENQHMGDDM
VQEPGLVMIFAHGVEEI
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggggtatgatgtaacccgtttccagggggatgttgacgaagatcttatctgccctatt
tgcagtggagtcttggaggagccagtacaggcacctcattgtgaacatgctttctgcaac
gcctgcatcacccagtggttctctcagcaacagacatgtccagtggaccgtagtgttgtg
acggtcgcccatctgcgcccagtacctcggatcatgcggaacatgttgtcaaagctgcag
attgcctgtgacaacgctgtgttcggctgtagtgccgttgtccggcttgacaacctcatg
tctcacctcagcgactgtgagcacaacccgaagcggcctgtgacctgtgaacagggctgt
ggcctggagatgcccaaagatgagctgcccaaccataactgcattaagcacctgcgctca
gtggtacagcagcagcagacacgcatcgcagagctggagaagacgtcagctgaacacaaa
caccagctggcggagcagaagcgagacatccagctgctaaaggcatacatgcgtgcaatc
cgcagtgtcaaccccaaccttcagaacctggaggagacaattgaatacaacgagatccta
gagtgggtgaactcccttcagccagcaagagtgacccgctggggagggatgatctcgact
cctgatgctgtgctccaggctgtaatcaagcgctccctggtggagagtggctgtcctgct
tctattgtcaacgagctgattgaaaatgcccacgagcgtagctggccccagggtctggcc
acactagagactagacagatgaaccgacgctactatgagaactacgtggccaagcgcatc
cctggcaagcaggctgttgtcgtgatggcctgtgagaaccagcacatgggggatgacatg
gtgcaagagccaggccttgtcatgatatttgcgcatggcgtggaagagatataa

DBGET integrated database retrieval system