KEGG   Homo sapiens (human): 10193Help
Entry
10193             CDS       T01001                                 

Gene name
RNF41, FLRF, NRDP1
Definition
ring finger protein 41 (EC:6.3.2.-)
Orthology
K11981  
E3 ubiquitin-protein ligase NRDP1 [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13.13
AA seq 317 aa AA seqDB search
MGYDVTRFQGDVDEDLICPICSGVLEEPVQAPHCEHAFCNACITQWFSQQQTCPVDRSVV
TVAHLRPVPRIMRNMLSKLQIACDNAVFGCSAVVRLDNLMSHLSDCEHNPKRPVTCEQGC
GLEMPKDELPNHNCIKHLRSVVQQQQTRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAI
RSVNPNLQNLEETIEYNEILEWVNSLQPARVTRWGGMISTPDAVLQAVIKRSLVESGCPA
SIVNELIENAHERSWPQGLATLETRQMNRRYYENYVAKRIPGKQAVVVMACENQHMGDDM
VQEPGLVMIFAHGVEEI
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggggtatgatgtaacccgtttccagggggatgttgacgaagatcttatctgccctatt
tgcagtggagtcttggaggagccagtacaggcacctcattgtgaacatgctttctgcaac
gcctgcatcacccagtggttctctcagcaacagacatgtccagtggaccgtagtgttgtg
acggtcgcccatctgcgcccagtacctcggatcatgcggaacatgttgtcaaagctgcag
attgcctgtgacaacgctgtgttcggctgtagtgccgttgtccggcttgacaacctcatg
tctcacctcagcgactgtgagcacaacccgaagcggcctgtgacctgtgaacagggctgt
ggcctggagatgcccaaagatgagctgcccaaccataactgcattaagcacctgcgctca
gtggtacagcagcagcagacacgcatcgcagagctggagaagacgtcagctgaacacaaa
caccagctggcggagcagaagcgagacatccagctgctaaaggcatacatgcgtgcaatc
cgcagtgtcaaccccaaccttcagaacctggaggagacaattgaatacaacgagatccta
gagtgggtgaactcccttcagccagcaagagtgacccgctggggagggatgatctcgact
cctgatgctgtgctccaggctgtaatcaagcgctccctggtggagagtggctgtcctgct
tctattgtcaacgagctgattgaaaatgcccacgagcgtagctggccccagggtctggcc
acactagagactagacagatgaaccgacgctactatgagaactacgtggccaagcgcatc
cctggcaagcaggctgttgtcgtgatggcctgtgagaaccagcacatgggggatgacatg
gtgcaagagccaggccttgtcatgatatttgcgcatggcgtggaagagatataa

DBGET integrated database retrieval system