KEGG   Homo sapiens (human): 10193Help
Entry
10193             CDS       T01001                                 

Gene name
RNF41, FLRF, NRDP1, SBBI03
Definition
(RefSeq) ring finger protein 41 (EC:6.3.2.-)
  KO
K11981  
E3 ubiquitin-protein ligase NRDP1 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    10193 (RNF41)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     10193 (RNF41)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    10193 (RNF41)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    10193 (RNF41)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13.13
AA seq 317 aa AA seqDB search
MGYDVTRFQGDVDEDLICPICSGVLEEPVQAPHCEHAFCNACITQWFSQQQTCPVDRSVV
TVAHLRPVPRIMRNMLSKLQIACDNAVFGCSAVVRLDNLMSHLSDCEHNPKRPVTCEQGC
GLEMPKDELPNHNCIKHLRSVVQQQQTRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAI
RSVNPNLQNLEETIEYNEILEWVNSLQPARVTRWGGMISTPDAVLQAVIKRSLVESGCPA
SIVNELIENAHERSWPQGLATLETRQMNRRYYENYVAKRIPGKQAVVVMACENQHMGDDM
VQEPGLVMIFAHGVEEI
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggggtatgatgtaacccgtttccagggggatgttgacgaagatcttatctgccctatt
tgcagtggagtcttggaggagccagtacaggcacctcattgtgaacatgctttctgcaac
gcctgcatcacccagtggttctctcagcaacagacatgtccagtggaccgtagtgttgtg
acggtcgcccatctgcgcccagtacctcggatcatgcggaacatgttgtcaaagctgcag
attgcctgtgacaacgctgtgttcggctgtagtgccgttgtccggcttgacaacctcatg
tctcacctcagcgactgtgagcacaacccgaagcggcctgtgacctgtgaacagggctgt
ggcctggagatgcccaaagatgagctgcccaaccataactgcattaagcacctgcgctca
gtggtacagcagcagcagacacgcatcgcagagctggagaagacgtcagctgaacacaaa
caccagctggcggagcagaagcgagacatccagctgctaaaggcatacatgcgtgcaatc
cgcagtgtcaaccccaaccttcagaacctggaggagacaattgaatacaacgagatccta
gagtgggtgaactcccttcagccagcaagagtgacccgctggggagggatgatctcgact
cctgatgctgtgctccaggctgtaatcaagcgctccctggtggagagtggctgtcctgct
tctattgtcaacgagctgattgaaaatgcccacgagcgtagctggccccagggtctggcc
acactagagactagacagatgaaccgacgctactatgagaactacgtggccaagcgcatc
cctggcaagcaggctgttgtcgtgatggcctgtgagaaccagcacatgggggatgacatg
gtgcaagagccaggccttgtcatgatatttgcgcatggcgtggaagagatataa

DBGET integrated database retrieval system