KEGG   Homo sapiens (human): 101930111Help
Entry
101930111         CDS       T01001                                 

Definition
(RefSeq) putative exonuclease GOR
  KO
K14570  
RNA exonuclease 1 [EC:3.1.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    101930111
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     101930111
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    101930111
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
8
AA seq 944 aa AA seqDB search
MLRATAPCWFPPGYPEAKKVAEEAALEAPEFPLPSHQPAQSFGLWVPQMHKQASAFVDIQ
AEPQNRGPAVPPAWPKMVTESCYFPAQRGSACRLPAAPRLTERPSGVRISAPRKRKTIAH
SSSPCLVTGYTDAKRTRVASSSQRSRGSKVGRQPGKTRNRSGMACKTTATTSSKRIVRRA
SLPSLSLKKPIILRSSGCQVPTVLRRGYLQLFTEECLKFCASKQEAEEKALNEEKVAYDC
SPNKNRYLNVVLNTLKRLKGLTPSSMPGLSRAALYSRLQEFLLTQDQLKENGYPFPHPER
PGGAVLFTGQGKGPGDSSCRVCCRCGTEYLVSSSGRCVRDQLCYYHWGRVRSSQVAGGRV
SQYTCCAAAPGSVGCQVAKQHVRDGRKESLDGFVETFKKELSRDAYPGIYALDCEMCYTT
HGLELTRVTVVDADMRVVYDTFVKPDNEIVDYNTRFSGVTEADVAKTSITCPKSPAQRGS
ACRLPAAPKGYTDAKRTRVASSSQRSRGSKVGRQPGKTRNRSGMACKTTATTSSKRIVRR
ASLPSLSLKKPIILRSSGCQVPTVLRRGYLQLFTEECLKFCASKQEAEEKALNEEKVAYD
CSPNKNRYLNVVLNTLKRLKGLTPSSMPGLSRAALYSRLQEFLLTQDQLKENGYPFPHPE
RPGGAVLFTGQGKGPGDSSCRVCCRCGTEYLVSSSGRCVRDQLCYYHWGRVRSSQVAGGR
VSQYTCCAAAPGSVGCQVAKQHVRDGRKESLDGFVETFKKELSRDAYPGIYALDCEMCYT
THGLELTRVTVVDADMRVVYDTFVKPDNEIVDYNTRFSGVTEADVAKTSITLPQVQAILL
SFFGAQTILIGHSLESDLLALKLIHSTVVDTAVLFPHYLGFPYKRSLRNLAADYLAQIIQ
DSQDGHNSSEDANACLQLVMWKVRQRAQIQPRHRSASPAALACP
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgagccacagctccctgctggttcccacctggatacccagaagctaagaaggtg
gccgaggaggcggccctcgaggctccagaattcccactgccctctcatcagcctgcccag
agcttcgggctctgggtgccccagatgcacaagcaggcctcagcatttgtggacatccag
gcggagccccagaacaggggtccggcggtgcccccagcgtggcccaagatggtgacggag
tcgtgctacttccctgcgcagaggggatcggcctgccgcttgccagccgccccaaggctg
acagagaggccctcgggagtccgcatctcagcccccaggaagaggaagacgatcgcccac
tcttccagcccttgcttggtcacaggttacacagatgccaagagaacccgggtggccagc
agcagccaacgctcccgtggctccaaggtcggcagacagccagggaagacgcgcaacagg
tcagggatggcatgcaagaccaccgccaccaccagctctaagcgaatcgtccgtcgtgca
tccttaccgagtttgagtttgaagaaacccattatcctccgaagctctgggtgccaagtc
cccaccgtcctccgccgaggctatctccagctgttcaccgaagagtgtctcaagttctgc
gcctccaagcaggaggccgaggagaaggcgctgaacgaggagaaggtggcctacgactgc
agccccaacaagaacaggtacctgaacgtggtcctgaacaccctcaagagactgaagggc
ctgacccccagctccatgcccggcctcagcagggccgccctgtacagccgcctccaggag
ttcctgctcacccaggaccagctcaaggagaacggctaccccttcccgcaccccgagcgg
cccggaggcgccgtcctcttcactggccaggggaaggggcccggcgactcctcctgcagg
gtctgctgccgttgtggcaccgagtacctggtgtcctcctcgggccgctgtgtacgcgac
cagttgtgttattatcactgggggcgggtccgctcgagccaggtggctggaggccgggtt
agccagtacacctgctgtgcagctgctcctggctctgtgggctgccaggtggcaaagcag
cacgtgcgggacggccgcaaggagagcctcgatggcttcgtggagaccttcaagaaagag
ttgtccagagacgcttatccaggaatctacgccttggactgtgagatgtgctacaccacg
catggcctagagctgacccgcgtcaccgtggtggacgccgacatgcgagtggtgtacgac
accttcgtcaagcccgacaacgagatcgtggactacaacaccaggttttccggagtcacc
gaggccgacgtcgccaagacgagcatcacgtgccccaagtcccctgcgcagaggggatcg
gcctgccgcttgccagccgcccccaagggttacacagatgccaagagaacccgggtggcc
agcagcagccaacgctcccgtggctccaaggtcggcagacagccagggaagacgcgcaac
aggtcagggatggcatgcaagaccaccgccaccaccagctctaagcgaatcgtccgtcgt
gcatccttaccgagtttgagtttgaagaaacccattatcctccgaagctctgggtgccaa
gtccccaccgtcctccgccgaggctatctccaactgttcaccgaagagtgtctcaagttc
tgcgcctccaagcaggaggccgaggagaaggcgctgaacgaggagaaggtggcctacgac
tgcagccccaacaagaacaggtacctgaacgtggtcctgaacaccctcaagagactgaag
ggcctgacccccagctccatgcccggcctcagcagggccgccctgtacagccgcctccag
gagttcctgctcacccaggaccagctcaaggagaacggctaccccttcccgcaccccgag
cggcccggaggcgccgtcctcttcactggccaggggaaggggcccggcgactcctcctgc
agggtctgctgccgttgtggcaccgagtacctggtgtcctcctcgggccgctgtgtacgc
gaccagttgtgttattatcactgggggcgggtccgctcgagccaggtggctggaggccgg
gttagccagtacacctgctgtgcagctgctcctggctctgtgggctgccaggtggcaaag
cagcacgtgcgggacggccgcaaggagagcctcgatggcttcgtggagaccttcaagaaa
gagttgtccagagacgcttatccaggaatctacgccttggactgtgagatgtgctacacc
acgcatggcctagagctgacccgcgtcaccgtggtggacgccgacatgcgagtggtgtac
gacaccttcgtcaagcccgacaacgagatcgtggactacaacaccaggttttccggagtc
accgaggccgacgtcgccaagacgagcatcacgttgccccaagtccaagccatcctgctg
agctttttcggcgcccaaaccatcctcatcgggcacagcctggagagcgacctgctggcc
ctgaagctcatccacagcaccgtggtggacacggccgtgctcttcccgcactacctgggt
ttcccctacaagcgctccctcaggaatctcgcggccgactacctggcacagatcatccag
gacagccaggacggccacaactccagcgaggacgcaaacgcctgcctgcagctggtgatg
tggaaggtccgacagcgcgcccagatccagccacgccaccggtccgcctctcccgccgcc
ctggcctgtccttag

DBGET integrated database retrieval system