KEGG   Homo sapiens (human): 101930123Help
Entry
101930123         CDS       T01001                                 

Definition
(RefSeq) eukaryotic elongation factor 2 kinase
  KO
K08292  elongation factor 2 kinase [EC:2.7.11.20]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04152  AMPK signaling pathway
hsa04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    101930123
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    101930123
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     101930123
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  Alpha family [OT]
   101930123
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha_kinase Sel1
Motif
Other DBs
NCBI-GeneID: 101930123
NCBI-ProteinID: XP_005276554
UniProt: O00418
Structure
PDB: 

Jmol
Position
16
AA seq 725 aa AA seqDB search
MADEDLIFRLEGVDGGQSPRAGHDGDSDGDSDDEEGYFICPITDDPSSNQNVNSKVNKYY
SNLTKSERYSSSGSPANSFHFKEAWKHAIQKAKHMPDPWAEFHLEDIATERATRHRYNAV
TGEWLDDEVLIKMASQPFGRGAMRECFRTKKLSNFLHAQQWKGASNYVAKRYIEPVDRDV
YFEDVRLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELKDRPGKPLFHLEHYIEGKYIKYN
SNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTETGTDFGDGNL
GVRGMALFFYSHACNRICESMGLAPFDLSPRERDAVNQNTKLLQSAKTILRGTEEKCGSP
RVRTLSGSRPPLLRPLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFSDLDN
MASRDHDHLDNHRESENSGDSGYPSEKRGELDDPEPREHGHSYSNRKYESDEDSLGSSGR
VCVEKWNLLNSSRLHLPRASAVALEVQRLNALDLEKKIGKSILGKVHLAMVRYHEGGRFC
EKGEEWDQESAVFHLEHAANLGELEAIVGLGLMYSQLPHHILADVSLKETEENKTKGFDY
LLKAAEAGDRQSMILVARAFDSGQNLSPDRCQDWLEALHWYNTALEMTDCDEGGEYDGMQ
DEPRYMMLAREAEMLFTGGYGLEKDPQRSGDLYTQAAEAAMEAMKGRLANQYYQKAEEAW
AQMEE
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgaagatctcatcttccgcctggaaggcgttgatggcggccagtccccccga
gctggccatgatggtgattctgatggggacagcgacgatgaggaaggttacttcatctgc
cccatcacggatgacccaagctcgaaccagaatgtcaattccaaggttaataagtactac
agcaacctaacaaaaagtgagcggtatagctccagcgggtccccggcaaactccttccac
ttcaaggaagcctggaagcacgcaatccagaaggccaagcacatgcccgacccctgggct
gagttccacctggaagatattgccaccgaacgtgctactcgacacaggtacaacgccgtc
accggggaatggctggatgatgaagttctgatcaagatggcatctcagcccttcggccga
ggagcaatgagggagtgcttccggacgaagaagctctccaacttcttgcatgcccagcag
tggaagggcgcctccaactacgtggcgaagcgctacatcgagcccgtagaccgggatgtg
tactttgaggacgtgcgtctacagatggaggccaagctctggggggaggagtataatcgg
cacaagccccccaagcaggtggacatcatgcagatgtgcatcatcgagctgaaggacaga
ccgggcaagcccctcttccacctggagcactacatcgagggcaagtacatcaagtacaac
tccaactctggctttgtccgcgatgacaacatccgcctgacgccgcaggccttcagccac
ttcacttttgagcgttccggccatcagctgatagtggtggacatccagggagttggggat
ctctacactgacccacagatccacacggagacgggcactgactttggagacggcaaccta
ggtgtccgcgggatggcgctcttcttctactctcatgcctgcaaccggatttgcgagagc
atgggccttgctccctttgacctctcgccccgggagagggatgcagtgaatcagaacacc
aagctgctgcaatcagccaagaccatcttgagaggaacagaggaaaaatgtgggagcccc
cgagtaaggaccctctctgggagccggccacccctgctccgtcccctttcagagaactct
ggagacgagaacatgagcgacgtgaccttcgactctctcccttcttccccatcttcggcc
acaccacacagccagaagctagaccacctccattggccagtgttcagtgacctcgataac
atggcatccagagaccatgatcatctagacaaccaccgggagtctgagaatagtggggac
agcggataccccagtgagaagcggggtgagctggatgaccctgagccccgagaacatggc
cactcatacagtaatcggaagtacgagtctgacgaagacagcctgggcagctctggacgg
gtatgtgtagagaagtggaatctcctcaactcctcccgcctccacctgccgagggcttcg
gccgtggccctggaagtgcaaaggcttaatgctctggacctcgaaaagaaaatcgggaag
tccattttggggaaggtccatctggccatggtgcgctaccacgagggtgggcgcttctgc
gagaagggcgaggagtgggaccaggagtcggctgtcttccacctggagcacgcagccaac
ctgggcgagctggaggccatcgtgggcctgggactcatgtactcgcagttgcctcatcac
atcctagccgatgtctctctgaaggagacagaagagaacaaaaccaaaggatttgattac
ttactaaaggccgctgaagctggcgacaggcagtccatgatcctagtggcgcgagctttt
gactctggccagaacctcagcccggacaggtgccaagactggctagaggccctgcactgg
tacaacactgccctggagatgacggactgtgatgagggcggtgagtacgacggaatgcag
gacgagccccggtacatgatgctggccagggaggccgagatgctgttcacaggaggctac
gggctggagaaggacccgcagagatcaggggacttgtatacccaggcagcagaggcagcg
atggaagccatgaagggccgactggccaaccagtactaccaaaaggctgaagaggcctgg
gcccagatggaggagtaa

DBGET integrated database retrieval system