KEGG   Homo sapiens (human): 10200Help
Entry
10200             CDS       T01001                                 

Gene name
MPHOSPH6, MPP, MPP-6, MPP6
Definition
(RefSeq) M-phase phosphoprotein 6
  KO
K12593  M-phase phosphoprotein 6, animal type
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    10200 (MPHOSPH6)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Exosome cofactors
     10200 (MPHOSPH6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MPP6 cwf18 CRF-BP
Motif
Other DBs
NCBI-GeneID: 10200
NCBI-ProteinID: NP_005783
OMIM: 605500
HGNC: 7214
Ensembl: ENSG00000135698
Vega: OTTHUMG00000137632
Pharos: Q99547(Tbio)
UniProt: Q99547
Position
16q23.3
AA seq 160 aa AA seqDB search
MAAERKTRLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESFIIE
EQSFLLCEDLLYGRMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMARRYET
LVGTIGKKFARKRDHANYEEDENGDITPIKAKKMFLKPQD
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgagcgaaagacaaggttgtccaagaatctactgcgcatgaagtttatgcaa
aggggactggactcagaaaccaagaaacaactagaagaagaagaaaagaaaatcattagt
gaagagcactggtacttggatttgccagagcttaaagagaaagagagtttcataatagaa
gagcagagtttcttactatgtgaagatcttctctatggaagaatgtcattcagaggattt
aatcctgaggttgagaaattgatgcttcagatgaatgctaagcacaaagcagaagaagtt
gaagatgaaacagtagagcttgatgtgtcagatgaagagatggctagaagatatgagacc
ttggtggggacaattgggaaaaagtttgccagaaagagagaccatgccaattatgaagaa
gatgaaaatggagacataacaccaattaaagcaaagaagatgttcttaaagccccaggat
taa

DBGET integrated database retrieval system