KEGG   Homo sapiens (human): 10200Help
Entry
10200             CDS       T01001                                 

Gene name
MPHOSPH6, MPP, MPP-6, MPP6
Definition
M-phase phosphoprotein 6
Orthology
K12593  
M-phase phosphoprotein 6, animal type
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    10200 (MPHOSPH6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q23.3
AA seq 160 aa AA seqDB search
MAAERKTRLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESFIIE
EQSFLLCEDLLYGRMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMARRYET
LVGTIGKKFARKRDHANYEEDENGDITPIKAKKMFLKPQD
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgagcgaaagacaaggttgtccaagaatctactgcgcatgaagtttatgcaa
aggggactggactcagaaaccaagaaacaactagaagaagaagaaaagaaaatcattagt
gaagagcactggtacttggatttgccagagcttaaagagaaagagagtttcataatagaa
gagcagagtttcttactatgtgaagatcttctctatggaagaatgtcattcagaggattt
aatcctgaggttgagaaattgatgcttcagatgaatgctaagcacaaagcagaagaagtt
gaagatgaaacagtagagcttgatgtgtcagatgaagagatggctagaagatatgagacc
ttggtggggacaattgggaaaaagtttgccagaaagagagaccatgccaattatgaagaa
gatgaaaatggagacataacaccaattaaagcaaagaagatgttcttaaagccccaggat
taa

DBGET integrated database retrieval system