KEGG   Homo sapiens (human): 10207Help
Entry
10207             CDS       T01001                                 

Gene name
INADL, Cipp, PATJ, hINADL
Definition
InaD-like (Drosophila)
Orthology
K06092  
InaD-like protein
Organism
hsa  Homo sapiens (human)
Pathway
Hippo signaling pathway
Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    10207 (INADL)
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    10207 (INADL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p31.3
AA seq 1801 aa AA seqDB search
MPENPATDKLQVLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQL
KGQLNHIPSDCSANFDFSRKGLLVFTDGSITNGNVHRPSNNSTVSGLFPWTPKLGNEDFN
SVIQQMAQGRQIEYIDIERPSTGGLGFSVVALRSQNLGKVDIFVKDVQPGSVADRDQRLK
ENDQILAINHTPLDQNISHQQAIALLQQTTGSLRLIVAREPVHTKSSTSSSLNDTTLPET
VCWGHVEEVELINDGSGLGFGIVGGKTSGVVVRTIVPGGLADRDGRLQTGDHILKIGGTN
VQGMTSEQVAQVLRNCGNSVRMLVARDPAGDISVTPPAPAALPVALPTVASKGPGSDSSL
FETYNVELVRKDGQSLGIRIVGYVGTSHTGEASGIYVKSIIPGSAAYHNGHIQVNDKIVA
VDGVNIQGFANHDVVEVLRNAGQVVHLTLVRRKTSSSTSPLEPPSDRGTVVEPLKPPALF
LTGAVETETNVDGEDEEIKERIDTLKNDNIQALEKLEKVPDSPENELKSRWENLLGPDYE
VMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSIVSGGPVDTLGLLQP
EDELLEVNGMQLYGKSRREAVSFLKEVPPPFTLVCCRRLFDDEASVDEPRRTETSLPETE
VDHNMDVNTEEDDDGELALWSPEVKIVELVKDCKGLGFSILDYQDPLDPTRSVIVIRSLV
ADGVAERSGGLLPGDRLVSVNEYCLDNTSLAEAVEILKAVPPGLVHLGICKPLVEDNEEE
SCYILHSSSNEDKTEFSGTIHDINSSLILEAPKGFRDEPYFKEELVDEPFLDLGKSFHSQ
QKEIEQSKEAWEMHEFLTPRLQEMDEEREMLVDEEYELYQDPSPSMELYPLSHIQEATPV
PSVNELHFGTQWLHDNEPSESQEARTGRTVYSQEAQPYGYCPENVMKENFVMESLPSVPS
TEGNSQQGRFDDLENLNSLAKTSLDLGMIPNDVQGPSLLIDLPVVAQRREQEDLPLYQHQ
ATRVISKASAYTGMLSSRYATDTCELPEREEGEGEETPNFSHWGPPRIVEIFREPNVSLG
ISIVGGQTVIKRLKNGEELKGIFIKQVLEDSPAGKTNALKTGDKILEVSGVDLQNASHSE
AVEAIKNAGNPVVFIVQSLSSTPRVIPNVHNKANKITGNQNQDTQEKKEKRQGTAPPPMK
LPPPYKALTDDSDENEEEDAFTDQKIRQRYADLPGELHIIELEKDKNGLGLSLAGNKDRS
RMSIFVVGINPEGPAAADGRMRIGDELLEINNQILYGRSHQNASAIIKTAPSKVKLVFIR
NEDAVNQMAVTPFPVPSSSPSSIEDQSGTEPISSEEDGSVEVGIKQLPESESFKLAVSQM
KQQKYPTKVSFSSQEIPLAPASSYHSTDADFTGYGGFQAPLSVDPATCPIVPGQEMIIEI
SKGRSGLGLSIVGGKDTPLNAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRNSSHEE
AITALRQTPQKVRLVVYRDEAHYRDEENLEIFPVDLQKKAGRGLGLSIVGKRNGSGVFIS
DIVKGGAADLDGRLIQGDQILSVNGEDMRNASQETVATILKCAQGLVQLEIGRLRAGSWT
SARTTSQNSQGSQQSAHSSCHPSFAPVITGLQNLVGTKRVSDPSQKNSGTDMEPRTVEIN
RELSDALGISIAGGRGSPLGDIPVFIAMIQASGVAARTQKLKVGDRIVSINGQPLDGLSH
ADVVNLLKNAYGRIILQVVADTNISAIAAQLENMSTGYHLGSPTAEHHPEDTEEQLQMTA
D
NT seq 5406 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaaatcctgctacagataaactgcaggtgctgcaggtacttgatcgcctgaaa
atgaaattgcaggagaagggtgacacgtcgcagaatgagaagttatctatgttttatgag
acactaaagagtcctctcttcaaccagatactcacacttcagcagtccatcaagcaactg
aagggtcaactcaaccatataccctcagattgttcagccaactttgatttttctaggaaa
ggtttgttagtgttcacagatggttccattactaatggaaatgtccacaggccctctaat
aactcgactgtatctgggttatttccgtggaccccgaagttgggaaatgaagactttaac
tcagtcattcaacagatggctcagggccggcaaattgaatatatagatatagaacggcct
tcaactggaggccttggattcagtgtggtggccctcagaagtcaaaatctcggaaaagtt
gatatcttcgtgaaggatgtccagccagggagtgtagcagacagggatcaaagattaaag
gaaaatgatcaaatattggccattaatcacacgccattggatcagaacatttcccatcag
caagcaattgcattattacaacaaaccactggatctttgagactgattgtggccagggaa
ccagtccacacaaaaagcagtacttctagcagcctaaatgatacaactctgcctgaaaca
gtttgttggggccatgttgaagaggttgagctcattaatgatggctctggactaggtttt
ggaatagttggaggaaaaacaagtggcgtggttgtgaggactatagttcctggaggatta
gcagatcgagatggaagactccagacaggggaccacatcttgaagattggtggcacaaac
gtgcagggaatgaccagtgagcaagttgcacaagttctaaggaactgtgggaattcagtc
aggatgctcgttgctagagatccagctggtgacatttcagtcaccccccctgcccctgca
gccttacctgttgccctgcctactgtagccagcaagggccctggttctgacagttctctt
tttgaaacttataatgttgagcttgtgagaaaagatgggcagagtcttggaattagaatt
gttggctatgttggaacatctcatacaggggaagcttcagggatttatgtgaaaagtata
atacctggcagtgctgcgtaccacaatggccacattcaagtgaatgacaaaatagttgct
gtcgatggcgtgaacattcagggttttgccaaccatgatgttgttgaagtattacgaaat
gcagggcaggtggtacacctaaccctagttcgaaggaagacatcctcatctacttctcca
cttgaaccaccttcagacagaggaactgttgtagaaccactgaaaccaccagctctcttt
ctaactggagcagtggaaactgaaactaatgtggatggtgaagatgaggaaattaaagaa
agaattgatactttaaaaaatgacaacatacaagccttagaaaaattggaaaaagtccca
gactctccagaaaatgagctgaaatccagatgggaaaacctgttgggtcctgattatgaa
gtaatggttgctactttggacacacagattgcagatgatgctgagttacagaaatattca
aagctgctgcctattcacactctgaggcttggtgtggaagtggattcctttgatgggcac
cattatatttcttcaattgtttctggtggtcctgttgatacattgggtctcctacagcca
gaagatgagctgcttgaggtcaatggcatgcagctttatggaaaatctcgccgagaagca
gtctcctttcttaaagaagtgccacccccttttactttggtttgctgtcggaggttgttt
gatgatgaagcttctgtagatgaaccaaggcgcactgaaacctctcttcctgagacagag
gttgaccacaatatggatgtcaatactgaagaagatgatgatggggaattagcactgtgg
tcccctgaagtcaagattgttgaactagtaaaagattgtaaaggtttgggattcagcatt
ttggattaccaggaccctttagatcctacaagatcagtgattgtgatccgctccctggta
gcagatggtgtagcagaaagaagtgggggactattacctggagaccgcctggtctcagtc
aatgaatactgtttggacaacacctcacttgctgaagctgtggaaatattgaaagctgtg
ccaccaggcctagtacaccttggcatctgtaagcctttggtggaagataatgaagaagaa
agttgttatattttacattcaagcagtaatgaagacaagactgaattttcaggaacaatt
catgatataaattcatctttaatactcgaagcacccaagggatttagagatgaaccatat
tttaaagaagaacttgtggatgaaccatttctagatctgggaaagtctttccattcccaa
caaaaagagatagagcaaagcaaggaggcctgggagatgcatgaatttctgactcctaga
ttgcaggaaatggatgaagaaagagaaatgcttgttgatgaagaatatgagttatatcaa
gatccctcaccatccatggagttgtatcccttgtcgcacattcaagaggccactcctgtg
ccctctgtgaatgaacttcactttggtacacagtggttgcatgataatgaaccatccgag
tctcaagaggcaagaaccgggaggactgtctattcccaggaggcacagccgtatggctat
tgccctgaaaatgtgatgaaagaaaattttgtcatggagtccctaccatctgtaccatca
actgaaggaaacagtcaacaaggcagatttgacgacctggaaaatcttaattcattagca
aaaactagtctggatttaggcatgatcccgaatgatgtccaaggtcctagcttgctcatt
gaccttcctgttgtggctcaaaggagggagcaagaagatttgcctttatatcaacaccaa
gcgacacgagttatttccaaggcctcagcatacacaggaatgttgtcttctagatatgcc
actgatacatgtgagttacctgagagagaagaaggcgaaggagaagaaactccaaatttt
agccactggggtccaccgagaattgttgagatttttagagaacccaatgtgtctcttggg
atcagtattgttggtggacaaactgttataaaacgtctaaagaatggagaggagcttaaa
ggtatattcatcaaacaagttttagaagacagtccagcagggaagacgaacgcacttaaa
actggagataaaatacttgaggtgtctggagtagatttgcagaatgcctcacacagcgaa
gcagttgaggccattaagaatgcaggaaaccctgtggtgttcattgttcagagtttgtca
tccactccacgagtcattcctaacgtacataacaaggccaacaaaatcaccggtaaccag
aaccaggacacccaagaaaagaaagaaaagaggcaaggaactgctccaccgccaatgaaa
cttcctcctccttataaagctctgactgatgacagtgatgaaaatgaagaagaagatgcc
tttaccgaccaaaaaatcagacaaagatatgcagatctgcctggagaactgcacattatt
gaacttgaaaaagataagaatggacttggactcagccttgctggtaataaagaccgatca
cgcatgagcatatttgtggtgggaattaacccggaaggacctgctgccgcagatggacga
atgcgtattggagatgaactcttagagataaacaatcagattctgtatggaagaagtcac
caaaatgcatctgccattattaagactgccccatcaaaggtcaagctggttttcatcaga
aacgaggatgcagtcaatcagatggccgttactccctttccagtgccatcaagttctcca
tcttctattgaggatcagagcggcaccgaacctattagtagtgaggaagatggcagcgtc
gaagttggtattaaacaattgcctgaaagtgaaagcttcaaactggctgtcagccagatg
aaacagcaaaaatatccaacaaaagtctccttcagttcacaagagataccattagcacca
gcttcatcataccattcaacagatgcagacttcacaggctatggtggtttccaggctcct
ctgtcagtggaccccgcaacgtgtcccattgtccctggacaggaaatgattatagaaata
tccaagggacgttcagggcttggtctcagcattgtgggaggaaaagacacacccttgaat
gctatagttatccatgaagtctatgaagaaggggcagcagccagagatggaagactttgg
gctggtgaccagatattagaggttaatggggttgacctgaggaactccagccacgaagaa
gccatcacagccctgaggcagaccccccagaaggtgcggctggtggtgtatagagatgag
gcacactaccgggatgaggagaacttggagattttccctgtggatctgcagaagaaagct
ggccggggcctgggcctgagcatcgttgggaaacgaaatggaagcggagtgtttatttct
gacatcgtgaaaggcggagccgcagacctggatgggagattgattcagggagatcagatc
ttatctgtgaatggggaggacatgagaaatgcctcacaggagacagtggccaccatcctc
aagtgtgcacagggacttgtgcagctagagattggaagactccgagctggttcctggacc
tccgcaaggacgacatcacagaacagtcagggtagtcagcagagtgcacacagcagctgt
catccctccttcgctcctgtcatcactggcctgcaaaacctggttggcacaaaaagagtt
tcagatccttcccagaaaaattcaggcacagatatggaaccaaggactgttgagataaac
agggagctcagtgatgcccttggaatcagtattgctggaggaagaggaagtcccttagga
gatatccccgtatttattgccatgattcaggctagcggagtggccgcacggacacagaag
cttaaagttggagatcggattgtcagcattaacgggcaacctttggatgggctgtctcac
gcggatgtggttaatctgctgaagaacgcctacgggcgcattatcctgcaggttgtagca
gataccaatataagcgccatagcagctcagcttgaaaacatgtctacaggctaccacctt
ggttcgcccactgctgaacaccatccagaagacacagaggagcagctgcagatgacggcc
gattaa

DBGET integrated database retrieval system