KEGG   Homo sapiens (human): 10211Help
Entry
10211             CDS       T01001                                 

Gene name
FLOT1
Definition
flotillin 1
Orthology
K07192  
flotillin
Organism
hsa  Homo sapiens (human)
Pathway
Insulin signaling pathway
Class
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.3
AA seq 427 aa AA seqDB search
MFFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHG
VPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEI
YKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGE
AEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQL
QVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEA
EKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEK
LPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQVN
HKPLRTA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtttttcacttgtggcccaaatgaggccatggtggtctccgggttctgccgaagcccc
ccagtcatggtggctggagggcgtgtctttgtcctgccctgcatccaacagatccagagg
atctctctcaacacactgaccctcaatgtcaagagtgaaaaggtttacactcgccatggg
gtccccatctcagtcactggcattgcccaggtaaaaatccaggggcagaacaaggagatg
ttggcggccgcctgtcagatgttcctggggaagacggaggctgagattgcccacattgcc
ctggagacgttagagggccaccagagggccatcatggcccacatgactgtggaggagatc
tataaggacaggcagaaattctcagaacaggttttcaaagtggcctcctcagacctggtc
aacatgggcatcagtgtggttagctacactctgaaggacattcacgatgaccaggactat
ttgcactctttggggaaggctcgaacagctcaagtccaaaaagatgcacggattggagaa
gcagaggccaagagagatgctgggatccgggaagctaaagccaagcaggaaaaggtgtct
gctcagtacctgagtgagatcgagatggccaaggcacagagagattacgaactgaagaag
gccgcctatgacatcgaggtcaacacccgccgagcacaggctgacctggcctatcagctt
caggtggccaagactaagcagcagattgaggagcagcgggtgcaggtgcaggtggtggag
cgggcccagcaggtggcagtgcaggagcaggagatcgcccggcgggagaaggagctggag
gcccgggtgcggaagccagcggaagcggagcgctacaagctggagcgcctagccgaggca
gagaagtcccaactaattatgcaggcggaggcagaagccgcgtctgtgcggatgcgtggg
gaagctgaggcctttgccataggggcccgagcccgagccgaggctgagcagatggccaag
aaggcagaagccttccagctgtaccaagaggctgctcagctggacatgctgctagagaag
ctgccccaggtggcagaggagatcagtggtcccttgacttcagccaataagatcacactg
gtgtccagcggcagtgggaccatgggggcagccaaagtgactggggaagtactggacatt
ctaactcgcctgccagagagtgtggaaagactcacaggcgtgagcatctcccaggtgaat
cacaagcctttgagaacagcctga

DBGET integrated database retrieval system