KEGG   Homo sapiens (human): 102157402Help
Entry
102157402         CDS       T01001                                 

Gene name
AK6, AD-004, CGI-137, CINAP, CIP, hCINAP
Definition
(RefSeq) adenylate kinase 6
  KO
K18532  
adenylate kinase [EC:2.7.4.3]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Metabolic pathways
Ribosome biogenesis in eukaryotes
Module
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    102157402 (AK6)
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    102157402 (AK6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     102157402 (AK6)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    102157402 (AK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9Y3D8(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
5q13.2
AA seq 172 aa AA seqDB search
MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDR
VVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNI
QCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgttgcttccgaacatcctgctcaccggtacaccaggggttggaaaaaccacactaggc
aaagaacttgcgtcaaaatcaggactgaaatacattaatgtgggtgatttagctcgagaa
gagcaattgtatgatggctatgatgaagagtatgactgtcccattttagatgaagacaga
gtagttgatgagttagataaccaaatgagagaaggtggagttattgttgattaccatggt
tgtgatttcttccctgaacgctggtttcatatagtttttgtgctgagaacagataccaat
gtattgtacgaaagacttgaaacaaggggttataatgagaagaaactaacagacaatatt
cagtgtgagatttttcaagttctttatgaagaagccacagcatcctacaaggaagaaatc
gtgcatcagctgcccagtaataaaccagaagagctagaaaataatgtagatcagatcttg
aaatggattgagcagtggatcaaagatcataactcttga

DBGET integrated database retrieval system