KEGG   Homo sapiens (human): 10229Help
Entry
10229             CDS       T01001                                 

Gene name
COQ7, CAT5, CLK-1, CLK1
Definition
coenzyme Q7 homolog, ubiquinone (yeast)
Orthology
K06134  
ubiquinone biosynthesis monooxygenase Coq7 [EC:1.14.13.-]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Ubiquinone and other terpenoid-quinone biosynthesis [PATH:hsa00130]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p12.3
AA seq 179 aa AA seqDB search
MTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFN
ELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLME
EDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgactttagacaatatcagtcgggcagctgtggatcgaataatccgggtggatcatgca
ggcgaatatggagcaaaccgcatctatgccgggcagatggctgtcctgggtcggaccagc
gtcgggccagtcattcagaaaatgtgggatcaagaaaaggaccatttgaaaaagttcaat
gagttgatggttacgttcagggtccggccaacagttctgatgcccttgtggaacgtgctg
gggtttgcactgggggcggggaccgccttgctcgggaaggaaggtgccatggcctgcacc
gtggcggtggaagagagcatagcacatcactacaacaaccagatcaggacgctgatggag
gaggaccctgaaaaatacgaggaacttcttcagctgataaagaaatttcgggatgaagag
cttgagcaccatgacataggcctcgaccatgatgcagaattggctccagcctatgccgtc
ctgaagagcattatccaggccggatgcagagtggcgatatatttatcagaaagattataa

DBGET integrated database retrieval system