KEGG   Homo sapiens (human): 10229Help
Entry
10229             CDS       T01001                                 

Gene name
COQ7, CAT5, CLK-1, CLK1, COQ10D8
Definition
(RefSeq) coenzyme Q7, hydroxylase
  KO
K06134  
ubiquinone biosynthesis monooxygenase Coq7 [EC:1.14.13.-]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Module
Ubiquinone biosynthesis, eukaryotes, 4-hydroxybenzoate => ubiquinone
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    10229 (COQ7)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     10229 (COQ7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p12.3
AA seq 217 aa AA seqDB search
MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGE
YGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGF
ALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELE
HHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgagttgcgccggggcggcggcggctccccgcctttggcggctgcgcccgggggcccgg
cggtccctctcagcttatggaagaagaaccagtgtcagatttcgcagttcaggaatgact
ttagacaatatcagtcgggcagctgtggatcgaataatccgggtggatcatgcaggcgaa
tatggagcaaaccgcatctatgccgggcagatggctgtcctgggtcggaccagcgtcggg
ccagtcattcagaaaatgtgggatcaagaaaaggaccatttgaaaaagttcaatgagttg
atggttacgttcagggtccggccaacagttctgatgcccttgtggaacgtgctggggttt
gcactgggggcggggaccgccttgctcgggaaggaaggtgccatggcctgcaccgtggcg
gtggaagagagcatagcacatcactacaacaaccagatcaggacgctgatggaggaggac
cctgaaaaatacgaggaacttcttcagctgataaagaaatttcgggatgaagagcttgag
caccatgacataggcctcgaccatgatgcagaattggctccagcctatgccgtcctgaag
agcattatccaggccggatgcagagtggcgatatatttatcagaaagattataa

DBGET integrated database retrieval system