KEGG   Homo sapiens (human): 10235Help
Entry
10235             CDS       T01001                                 

Gene name
RASGRP2, CALDAG-GEFI, CDC25L
Definition
RAS guanyl releasing protein 2 (calcium and DAG-regulated)
Orthology
K12361  
RAS guanyl-releasing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Platelet activation
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    10235 (RASGRP2)
   04015 Rap1 signaling pathway
    10235 (RASGRP2)
   04010 MAPK signaling pathway
    10235 (RASGRP2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    10235 (RASGRP2)
   04062 Chemokine signaling pathway
    10235 (RASGRP2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    10235 (RASGRP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13
AA seq 609 aa AA seqDB search
MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIY
QQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLID
IDSVPTYKWKRQVTQRNPVGQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHS
FVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTAPQRALVITHFVHVAEKLLQLQNF
NTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELVTATGNYGNYRRRLAACVGFR
FPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPDL
LSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQ
ALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEM
VSYFLRSSSVLGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQC
KDRLSVECRRRAQSVSLEGSAPSPSPMHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQTV
EDGVFDIHL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaccctggacctggacaagggctgcacggtggaggagctgctccgcgggtgc
atcgaagccttcgatgactccgggaaggtgcgggacccgcagctggtgcgcatgttcctc
atgatgcacccctggtacatcccctcctctcagctggcggccaagctgctccacatctac
caacaatcccggaaggacaactccaattccctgcaggtgaaaacgtgccacctggtcagg
tactggatctccgccttcccagcggagtttgacttgaacccggagttggctgagcagatc
aaggagctgaaggctctgctagaccaagaagggaaccgacggcacagcagcctaatcgac
atagacagcgtccctacctacaagtggaagcggcaggtgactcagcggaaccctgtggga
cagaaaaagcgcaagatgtccctgttgtttgaccacctggagcccatggagctggcggag
catctcacctacttggagtatcgctccttctgcaagatcctgtttcaggactatcacagt
ttcgtgactcatggctgcactgtggacaaccccgtcctggagcggttcatctccctcttc
aacagcgtctcacagtgggtgcagctcatgatcctcagcaaacccacagccccgcagcgg
gccctggtcatcacacactttgtccacgtggcggagaagctgctacagctgcagaacttc
aacacgctgatggcagtggtcgggggcctgagccacagctccatctcccgcctcaaggag
acccacagccacgttagccctgagaccatcaagctctgggagggtctcacggaactagtg
acggcgacaggcaactatggcaactaccggcgtcggctggcagcctgtgtgggcttccgc
ttcccgatcctgggtgtgcacctcaaggacctggtggccctgcagctggcactgcctgac
tggctggacccagcccggacccggctcaacggggccaagatgaagcagctctttagcatc
ctggaggagctggccatggtgaccagcctgcggccaccagtacaggccaaccccgacctg
ctgagcctgctcacggtgtctctggatcagtatcagacggaggatgagctgtaccagctg
tccctgcagcgggagccgcgctccaagtcctcgccaaccagccccacgagttgcacccca
ccaccccggcccccggtactggaggagtggacctcggctgccaaacccaagctggatcag
gccctcgtggtggagcacatcgagaagatggtggagtctgtgttccggaactttgacgtc
gatggggatggccacatctcacaggaagaattccagatcatccgtgggaacttcccttac
ctcagcgcctttggggacctcgaccagaaccaggatggctgcatcagcagggaggagatg
gtttcctatttcctgcgctccagctctgtgttgggggggcgcatgggcttcgtacacaac
ttccaggagagcaactccttgcgccccgtcgcctgccgccactgcaaagccctgatcctg
ggcatctacaagcagggcctcaaatgccgagcctgtggagtgaactgccacaagcagtgc
aaggatcgcctgtcagttgagtgtcggcgcagggcccagagtgtgagcctggaggggtct
gcaccctcaccctcacccatgcacagccaccatcaccgcgccttcagcttctctctgccc
cgccctggcaggcgaggctccaggcctccagagatccgtgaggaggaggtacagacggtg
gaggatggggtgtttgacatccacttgtaa

DBGET integrated database retrieval system