KEGG   Homo sapiens (human): 10235Help
Entry
10235             CDS       T01001                                 

Gene name
RASGRP2, CALDAG-GEFI, CDC25L
Definition
RAS guanyl releasing protein 2 (calcium and DAG-regulated)
Orthology
K12361  
RAS guanyl-releasing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13
AA seq 609 aa AA seqDB search
MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIY
QQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLID
IDSVPTYKWKRQVTQRNPVGQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHS
FVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTAPQRALVITHFVHVAEKLLQLQNF
NTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELVTATGNYGNYRRRLAACVGFR
FPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPDL
LSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQ
ALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEM
VSYFLRSSSVLGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQC
KDRLSVECRRRAQSVSLEGSAPSPSPMHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQTV
EDGVFDIHL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaccctggacctggacaagggctgcacggtggaggagctgctccgcgggtgc
atcgaagccttcgatgactccgggaaggtgcgggacccgcagctggtgcgcatgttcctc
atgatgcacccctggtacatcccctcctctcagctggcggccaagctgctccacatctac
caacaatcccggaaggacaactccaattccctgcaggtgaaaacgtgccacctggtcagg
tactggatctccgccttcccagcggagtttgacttgaacccggagttggctgagcagatc
aaggagctgaaggctctgctagaccaagaagggaaccgacggcacagcagcctaatcgac
atagacagcgtccctacctacaagtggaagcggcaggtgactcagcggaaccctgtggga
cagaaaaagcgcaagatgtccctgttgtttgaccacctggagcccatggagctggcggag
catctcacctacttggagtatcgctccttctgcaagatcctgtttcaggactatcacagt
ttcgtgactcatggctgcactgtggacaaccccgtcctggagcggttcatctccctcttc
aacagcgtctcacagtgggtgcagctcatgatcctcagcaaacccacagccccgcagcgg
gccctggtcatcacacactttgtccacgtggcggagaagctgctacagctgcagaacttc
aacacgctgatggcagtggtcgggggcctgagccacagctccatctcccgcctcaaggag
acccacagccacgttagccctgagaccatcaagctctgggagggtctcacggaactagtg
acggcgacaggcaactatggcaactaccggcgtcggctggcagcctgtgtgggcttccgc
ttcccgatcctgggtgtgcacctcaaggacctggtggccctgcagctggcactgcctgac
tggctggacccagcccggacccggctcaacggggccaagatgaagcagctctttagcatc
ctggaggagctggccatggtgaccagcctgcggccaccagtacaggccaaccccgacctg
ctgagcctgctcacggtgtctctggatcagtatcagacggaggatgagctgtaccagctg
tccctgcagcgggagccgcgctccaagtcctcgccaaccagccccacgagttgcacccca
ccaccccggcccccggtactggaggagtggacctcggctgccaaacccaagctggatcag
gccctcgtggtggagcacatcgagaagatggtggagtctgtgttccggaactttgacgtc
gatggggatggccacatctcacaggaagaattccagatcatccgtgggaacttcccttac
ctcagcgcctttggggacctcgaccagaaccaggatggctgcatcagcagggaggagatg
gtttcctatttcctgcgctccagctctgtgttgggggggcgcatgggcttcgtacacaac
ttccaggagagcaactccttgcgccccgtcgcctgccgccactgcaaagccctgatcctg
ggcatctacaagcagggcctcaaatgccgagcctgtggagtgaactgccacaagcagtgc
aaggatcgcctgtcagttgagtgtcggcgcagggcccagagtgtgagcctggaggggtct
gcaccctcaccctcacccatgcacagccaccatcaccgcgccttcagcttctctctgccc
cgccctggcaggcgaggctccaggcctccagagatccgtgaggaggaggtacagacggtg
gaggatggggtgtttgacatccacttgtaa

DBGET integrated database retrieval system