KEGG   Homo sapiens (human): 10246Help
Entry
10246             CDS       T01001                                 

Gene name
SLC17A2, NPT3
Definition
(RefSeq) solute carrier family 17 member 2
  KO
K12300  
MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 1/2/3/4
Organism
hsa  Homo sapiens (human)
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC17: Vesicular glutamate transporter
   10246 (SLC17A2)
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    10246 (SLC17A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.3
AA seq 436 aa AA seqDB search
MDGKPATRKGPDFCSLRYGLALIMHFSNFTMITQRVSLSIAIIAMVNTTQQQGLSNASTE
GPVADAFNNSSISIKEFDTKASVYQWSPETQGIIFSSINYGIILTLIPSGYLAGIFGAKK
MLGAGLLISSLLTLFTPLAADFGVILVIMVRTVQGMAQGMAWTGQFTIWAKWAPPLERSK
LTTIAGSGSAFGSFIILCVGGLISQALSWPFIFYIFGSTGCVCCLLWFTVIYDDPMHHPC
ISVREKEHILSSLAQQPSSPGRAVPIKAMVTCLPLWAIFLGFFSHFWLCTIILTYLPTYI
STLLHVNIRDSGVLSSLPFIAAASCTILGGQLADFLLSRNLLRLITVRKLFSSLDMQVSS
WESQGDLGSSQESSLPLPLDSSSVRILSLVGGMSFSCLLQSTCLAWSFTSRLDKQNFKTG
PKRGPLPASEDIKLQT
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggacgggaagcctgccaccaggaaaggtccagatttctgttcattacgctatgggctg
gctcttatcatgcacttctcaaacttcaccatgataacgcagcgtgtgagtctgagcatt
gcgatcatcgccatggtgaacaccactcagcagcaaggtctatctaatgcctccactgag
gggcctgttgcagatgccttcaataactccagcatatccatcaaggaatttgatacaaag
gcctctgtgtatcaatggagcccagaaactcagggtatcatctttagctccatcaactat
gggataatactgactctgatcccaagtggatatttagcagggatatttggagcaaaaaaa
atgcttggtgctggtttgctgatctcttcccttctcaccctctttacaccactggctgct
gacttcggagtgattttggtcatcatggttcggacagtccagggcatggcccagggaatg
gcatggacaggtcagtttactatttgggcaaagtgggctcctccacttgaacgaagcaag
ctcaccaccattgcaggatcagggtcagcatttggatccttcatcatcctctgtgtgggg
ggactaatctcacaggccttgagctggccttttatcttctacatctttggtagcactggc
tgtgtctgctgtctcctatggttcacagtgatttatgatgaccccatgcatcacccgtgc
ataagtgttagggaaaaggagcacatcctgtcctcactggctcaacagcccagttctcct
ggacgagctgtccccataaaggcgatggtcacatgcctaccactttgggccattttcctg
ggttttttcagccatttctggttgtgcaccatcatcctaacatacctaccaacgtatatc
agtactctgctccatgttaacatcagagatagtggagttctgtcctccctgccttttatt
gctgctgcaagctgtacaattttaggaggtcagctggcagatttccttttgtccaggaat
cttctcagattgatcactgtgcgaaagctcttttcatctcttgatatgcaagtttcctca
tgggaatctcaaggggatttgggctcatcgcaggaatcatctcttccactgccactggat
tcctcatcagtcaggattttgagtctggttggaggaatgtctttttcctgtctgctgcag
tcaacatgtttggcctggtcttttacctcacgtttggacaagcagaacttcaagactggg
ccaaagagaggacccttacccgcctctgaggacataaagttacaaacttaa

DBGET integrated database retrieval system