KEGG   Homo sapiens (human): 10248Help
Entry
10248             CDS       T01001                                 

Gene name
POP7, 0610037N12Rik, RPP2, RPP20
Definition
processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae) (EC:3.1.26.5)
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:hsa03013]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:hsa03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q22
AA seq 140 aa AA seqDB search
MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGA
RGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREP
LTRIRNNSAIHIRVFRVTPK
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaccgagagccccgcggtgctgtggaggctgaactggatccagtggaatac
acccttaggaaaaggcttcccagccgcctgccccggagacccaatgacatttatgtcaac
atgaagacggactttaaggcccagctggcccgctgccagaagctgctggacggaggggcc
cggggtcagaacgcgtgctctgagatctacattcacggcttgggcctggccatcaaccgc
gccatcaacatcgcgctgcagctgcaggcgggcagcttcgggtccttgcaggtggctgcc
aatacctccaccgtggagcttgttgatgagctggagccagagaccgacacacgggagcca
ctgactcggatccgcaacaactcagccatccacatccgagtcttcagggtcacacccaag
taa

DBGET integrated database retrieval system