KEGG   Homo sapiens (human): 1025Help
Entry
1025              CDS       T01001                                 

Gene name
CDK9, C-2k, CDC2L4, CTK1, PITALRE, TAK
Definition
(RefSeq) cyclin dependent kinase 9 (EC:2.7.11.23 2.7.11.22)
  KO
K02211  
cyclin-dependent kinase 9 [EC:2.7.11.22 2.7.11.23]
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Drug target
Dinaciclib: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    1025 (CDK9)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     1025 (CDK9)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     1025 (CDK9)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   1025 (CDK9)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Super elongation complex (SEC)
     1025 (CDK9)
    Brd4/P-TEFb complex
     1025 (CDK9)
    7SK RNP complex
     1025 (CDK9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q34.1
AA seq 372 aa AA seqDB search
MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFP
ITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVK
FTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNS
QPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLAL
ISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDP
AQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNP
ATTNQTEFERVF
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcagtacgactcggtggagtgccctttttgtgatgaagtttccaaatacgag
aagctcgccaagatcggccaaggcaccttcggggaggtgttcaaggccaggcaccgcaag
accggccagaaggtggctctgaagaaggtgctgatggaaaacgagaaggaggggttcccc
attacagccttgcgggagatcaagatccttcagcttctaaaacacgagaatgtggtcaac
ttgattgagatttgtcgaaccaaagcttccccctataaccgctgcaagggtagtatatac
ctggtgttcgacttctgcgagcatgaccttgctgggctgttgagcaatgttttggtcaag
ttcacgctgtctgagatcaagagggtgatgcagatgctgcttaacggcctctactacatc
cacagaaacaagatcctgcatagggacatgaaggctgctaatgtgcttatcactcgtgat
ggggtcctgaagctggcagactttgggctggcccgggccttcagcctggccaagaacagc
cagcccaaccgctacaccaaccgtgtggtgacactctggtaccggcccccggagctgttg
ctcggggagcgggactacggcccccccattgacctgtggggtgctgggtgcatcatggca
gagatgtggacccgcagccccatcatgcagggcaacacggagcagcaccaactcgccctc
atcagtcagctctgcggctccatcacccctgaggtgtggccaaacgtggacaactatgag
ctgtacgaaaagctggagctggtcaagggccagaagcggaaggtgaaggacaggctgaag
gcctatgtgcgtgacccatacgcactggacctcatcgacaagctgctggtgctggaccct
gcccagcgcatcgacagcgatgacgccctcaaccacgacttcttctggtccgaccccatg
ccctccgacctcaagggcatgctctccacccacctgacgtccatgttcgagtacttggca
ccaccgcgccggaagggcagccagatcacccagcagtccaccaaccagagtcgcaatccc
gccaccaccaaccagacggagtttgagcgcgtcttctga

DBGET integrated database retrieval system