KEGG   Homo sapiens (human): 10250Help
Entry
10250             CDS       T01001                                 

Gene name
SRRM1, 160-KD, POP101, SRM160
Definition
(RefSeq) serine and arginine repetitive matrix 1
  KO
K13171  
serine/arginine repetitive matrix protein 1
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
mRNA surveillance pathway
Module
Exon junction complex (EJC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    10250 (SRRM1)
   03015 mRNA surveillance pathway
    10250 (SRRM1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     10250 (SRRM1)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   SR-related proteins
    10250 (SRRM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.11
AA seq 904 aa AA seqDB search
MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL
GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP
SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRERSRSPRRRKSRSP
SPRRRSSPVRRERKRSHSRSPRHRTKSRSPSPAPEKKEKTPELPEPSVKVKEPSVQEATS
TSDILKVPKPEPIPEPKEPSPEKNSKKEKEKEKTRPRSRSRSKSRSRTRSRSPSHTRPRR
RHRSRSRSYSPRRRPSPRRRPSPRRRTPPRRMPPPPRHRRSRSPVRRRRRSSASLSGSSS
SSSSSRSRSPPKKPPKRTSSPPRKTRRLSPSASPPRRRHRPSPPATPPPKTRHSPTPQQS
NRTRKSRVSVSPGRTSGKVTKHKGTEKRESPSPAPKPRKVELSESEEDKGGKMAAADSVQ
QRRQYRRQNQQSSSDSGSSSSSEDERPKRSHVKNGEVGRRRRHSPSRSASPSPRKRQKET
SPRGRRRRSPSPPPTRRRRSPSPAPPPRRRRTPTPPPRRRTPSPPPRRRSPSPRRYSPPI
QRRYSPSPPPKRRTASPPPPPKRRASPSPPPKRRVSHSPPPKQRSSPVTKRRSPSLSSKH
RKGSSPSRSTREARSPQPNKRHSPSPRPRAPQTSSSPPPVRRGASSSPQRRQSPSPSTRP
IRRVSRTPEPKKIKKAASPSPQSVRRVSSSRSVSGSPEPAAKKPPAPPSPVQSQSPSTNW
SPAVPVKKAKSPTPSPSPPRNSDQEGGGKKKKKKKDKKHKKDKKHKKHKKHKKEKAVAAA
AAAAVTPAAIAAATTTLAQEEPVAAPEPKKETESEAEDNLDDLEKHLREKALRSMRKAQV
SPQS
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgggatttttccgcggaacaagtgcagaacaggataatcggttcagcaacaaa
cagaagaaactactgaagcagctgaaatttgcagaatgcctagaaaaaaaggtggacatg
agcaaagtaaatttggaggttataaagccttggataacaaaaagagtaacggaaatcctt
gggtttgaagatgatgttgtgattgagtttatattcaaccagctggaagtgaagaatcca
gactccaaaatgatgcaaatcaacctgactggatttttgaatggaaaaaatgctcgagaa
tttatgggagaactgtggcccctgctgctaagtgcacaagaaaacatcgcgggaatccct
tctgctttcctagaactgaagaaagaagaaataaaacaaagacagattgaacaagaaaaa
ctggcatctatgaaaaagcaagatgaagacaaagataaaagagataaggaagaaaaagaa
agcagcagagaaaaaagggagcggtctcgtagcccaagaagacgcaaatccagatctcct
tcccctagaagacgatcttcccctgtcaggagagagagaaagcgcagtcattctcgatct
ccccgtcacagaaccaagagccggagtccttcccctgctccagaaaagaaggaaaaaact
ccagagctcccagaaccttcagtgaaagtaaaagaaccttcagtacaagaggctacttct
actagtgacattctgaaagttcccaaacctgaacctataccagagcctaaagaaccttct
ccggaaaaaaattccaaaaaagaaaaggagaaggagaagacccgaccacgatctcggtca
cgctccaaatcaagatcccggacgcggtcccgctctccttctcacactcgacctagacgg
cgccatagatcccgatcaagatcgtattcacctagaaggcggccaagcccaagaaggcgg
ccatctcctcgaagaagaactccgccaagaagaatgcctcctccaccaaggcatagaagg
agtagatctccagtaagacgaagaagacgttcgtcagcatccttgtctgggagtagctca
tcatcctcttcatctcgttcacggtcaccaccaaagaagcctcccaagaggacatccagc
ccccctcggaaaactcgtaggttatctccttcagcaagtcctccaaggcgaaggcacagg
ccatcacctcctgcaactccaccacccaaaactcggcattcccctacaccccagcagtca
aaccgtacaagaaaaagtcgtgtttctgtgtctccagggagaacttcaggtaaagtgaca
aaacataaaggtactgagaaaagagaatccccttcaccagcaccgaagcctagaaaagta
gagttatctgaatcggaagaagataaaggtggcaaaatggctgcagcagattctgtgcag
cagagacgccaatacagacgacaaaaccagcagtcttcatctgactctggctcctcctcc
tcctcagaagatgaacgacccaagagatcccatgtgaagaatggtgaggttggcaggcgg
cggagacattccccttcccggagtgcttctccatcaccacgaaagcgccaaaaagagact
tcccctcgtggtagacggaggagaagtccatccccaccacccaccagaaggcgacggtct
ccttctcccgcccctcctcctcgacggcgcaggactcccacaccaccaccacgacgaagg
actccttctcctcccccacgtcggcgctcaccttctcctagaagatactctcctccaata
cagaggagatactctccttctccacctccaaagagaagaacggcttcacctcctccccct
cctaaacgaagagcatcaccatctccaccaccaaagcggcgggtctcccattctccacct
cccaaacaaagaagctccccagtcaccaagagacgttcaccttcattatcatccaagcat
aggaaagggtcttccccaagccgctctacccgggaggcccgatcaccacaaccaaacaaa
cggcattcgccctcaccacggcctcgagctcctcagacctcctcaagtcctccacccgtt
cgaagaggagcgtcgtcatcaccccaaagaaggcagtccccgtctccaagtactaggccc
attaggagagtctccaggactccggaacctaaaaagataaaaaaggctgcttccccaagc
ccacagtctgtaagaagggtctcatcctcccgatctgtctccgggtctcctgagccagca
gctaaaaagcccccagcacctccatcccccgtccagtctcagtcaccgtctacaaactgg
tcaccagctgtaccggtcaaaaaggccaaaagcccaacaccgagcccatcaccgccaaga
aattcagatcaggaaggaggtggaaagaaaaagaagaaaaagaaggacaagaaacacaaa
aaggataagaagcacaagaagcacaaaaaacacaagaaggaaaaggctgtggctgcagct
gctgcagctgctgtgacccctgcagccattgcagctgccacaaccacattagcacaggaa
gagccagtggcagcgccagagccgaagaaggagactgaaagtgaagctgaagataacctt
gatgatttagaaaagcacctgcgtgaaaaggccctgagatcaatgaggaaggcccaagtg
tccccacagtcttag

DBGET integrated database retrieval system