KEGG   Homo sapiens (human): 10251Help
Entry
10251             CDS       T01001                                 

Gene name
SPRY3, HSPRY3, spry-3
Definition
sprouty homolog 3 (Drosophila)
Orthology
K17384  
protein sprouty homolog 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq28 and Yq12
AA seq 288 aa AA seqDB search
MDAAVTDDFQQILPIEQLRSTHASNDYVERPPAPCKQALSSPSLIVQTHKSDWSLATMPT
SLPRSLSQCHQLQPLPQHLSQSSIASSMSHSTTASDQRLLASITPSPSGQSIIRTQPGAG
VHPKADGALKGEAEQSAGHPSEHLFICEECGRCKCVPCTAARPLPSCWLCNQRCLCSAES
LLDYGTCLCCVKGLFYHCSTDDEDNCADEPCSCGPSSCFVRWAAMSLISLFLPCLCCYLP
TRGCLHLCQQGYDSLRRPGCRCKRHTNTVCRKISSGSAPFPKAQEKSV
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggatgctgcggtgacagatgattttcaacaaattctgcctattgaacagctgcgctct
actcatgctagcaatgactacgtggaacggcctccagccccctgtaaacaggccctctcc
agcccttcccttattgtgcaaacccacaagtctgattggtctctggctaccatgcctact
tctctcccccgcagtctcagccagtgccatcaactgcagcccttgcctcagcatctgagc
caatctagcattgccagctcaatgtcccatagcaccactgcctctgatcaaaggctcttg
gccagcattacaccctcaccttcaggccaatccatcatccgaacccaacctggagcaggg
gtccacccaaaggctgatggtgctctgaagggagaagctgagcaatctgcagggcaccct
agtgagcacctcttcatctgtgaggaatgtgggcgctgcaagtgcgtcccctgcacagca
gctcgccctctcccctcctgctggctgtgcaaccagcgctgcctttgctctgctgagagc
ctcctcgattatggcacttgtctctgctgtgtcaagggcctcttctaccactgctccact
gatgatgaagacaactgtgctgatgagccctgctcttgtgggcctagttcttgctttgtc
cgctgggcagccatgagcctcatctccctcttcctaccctgcctgtgctgctacctgcct
acccgtggatgcctccatctgtgccaacagggctatgatagcctccggcgaccaggctgc
cgctgcaagaggcacaccaacactgtgtgcagaaagatctcttctggtagtgcacccttc
cccaaggcccaggaaaagtctgtatga

DBGET integrated database retrieval system