KEGG   Homo sapiens (human): 10251Help
Entry
10251             CDS       T01001                                 

Gene name
SPRY3, spry-3
Definition
(RefSeq) sprouty RTK signaling antagonist 3
  KO
K17384  protein sprouty homolog 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Sprouty
Motif
Other DBs
NCBI-GeneID: 10251
NCBI-ProteinID: NP_001291919
OMIM: 300531
HGNC: 11271
Ensembl: ENSG00000168939
Vega: OTTHUMG00000022675
Pharos: O43610(Tdark)
UniProt: O43610 Q6ZUP3
Position
Xq28 and Yq12
AA seq 288 aa AA seqDB search
MDAAVTDDFQQILPIEQLRSTHASNDYVERPPAPCKQALSSPSLIVQTHKSDWSLATMPT
SLPRSLSQCHQLQPLPQHLSQSSIASSMSHSTTASDQRLLASITPSPSGQSIIRTQPGAG
VHPKADGALKGEAEQSAGHPSEHLFICEECGRCKCVPCTAARPLPSCWLCNQRCLCSAES
LLDYGTCLCCVKGLFYHCSTDDEDNCADEPCSCGPSSCFVRWAAMSLISLFLPCLCCYLP
TRGCLHLCQQGYDSLRRPGCRCKRHTNTVCRKISSGSAPFPKAQEKSV
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggatgctgcggtgacagatgattttcaacaaattctgcctattgaacagctgcgctct
actcatgctagcaatgactacgtggaacggcctccagccccctgtaaacaggccctctcc
agcccttcccttattgtgcaaacccacaagtctgattggtctctggctaccatgcctact
tctctcccccgcagtctcagccagtgccatcaactgcagcccttgcctcagcatctgagc
caatctagcattgccagctcaatgtcccatagcaccactgcctctgatcaaaggctcttg
gccagcattacaccctcaccttcaggccaatccatcatccgaacccaacctggagcaggg
gtccacccaaaggctgatggtgctctgaagggagaagctgagcaatctgcagggcaccct
agtgagcacctcttcatctgtgaggaatgtgggcgctgcaagtgcgtcccctgcacagca
gctcgccctctcccctcctgctggctgtgcaaccagcgctgcctttgctctgctgagagc
ctcctcgattatggcacttgtctctgctgtgtcaagggcctcttctaccactgctccact
gatgatgaagacaactgtgctgatgagccctgctcttgtgggcctagttcttgctttgtc
cgctgggcagccatgagcctcatctccctcttcctaccctgcctgtgctgctacctgcct
acccgtggatgcctccatctgtgccaacagggctatgatagcctccggcgaccaggctgc
cgctgcaagaggcacaccaacactgtgtgcagaaagatctcttctggtagtgcacccttc
cccaaggcccaggaaaagtctgtatga

DBGET integrated database retrieval system