KEGG   Homo sapiens (human): 10252Help
Entry
10252             CDS       T01001                                 

Gene name
SPRY1, hSPRY1
Definition
sprouty homolog 1, antagonist of FGF signaling (Drosophila)
Orthology
K04704  
protein sprouty homolog 1
Organism
hsa  Homo sapiens (human)
Pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    10252 (SPRY1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q28.1
AA seq 319 aa AA seqDB search
MDPQNQHGSGSSLVVIQQPSLDSRQRLDYEREIQPTAILSLDQIKAIRGSNEYTEGPSVV
KRPAPRTAPRQEKHERTHEIIPINVNNNYEHRHTSHLGHAVLPSNARGPILSRSTSTGSA
ASSGSNSSASSEQGLLGRSPPTRPVPGHRSERAIRTQPKQLIVDDLKGSLKEDLTQHKFI
CEQCGKCKCGECTAPRTLPSCLACNRQCLCSAESMVEYGTCMCLVKGIFYHCSNDDEGDS
YSDNPCSCSQSHCCSRYLCMGAMSLFLPCLLCYPPAKGCLKLCRRCYDWIHRPGCRCKNS
NTVYCKLESCPSRGQGKPS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggatccccaaaatcaacatggcagtggcagttcgttagttgtgatccagcagccttct
ttggatagccgtcagagattagactatgagagagagattcagcctactgctattttgtcc
ttagaccagatcaaggccataagaggcagcaatgaatacacagaagggccttcggtggtg
aaaagacctgctcctcggacagcaccaagacaagaaaagcatgaaaggactcatgaaatc
ataccaattaatgtgaataataactacgagcacagacacacaagccacctgggacatgca
gtactcccaagtaatgccaggggccccattttgagcagatcaaccagcactggaagtgca
gccagctctgggagcaacagcagtgcctcttctgaacagggactgttaggaaggtcacca
ccaaccagaccagtccctggtcataggtctgaaagggcaatccggacccagcccaagcaa
ctgattgtggatgacttgaagggttccttgaaagaggacctgacacagcacaagttcatt
tgtgaacagtgtgggaagtgcaagtgtggagaatgcactgctcccaggaccctaccatcc
tgtttggcctgtaaccggcagtgcctttgctctgctgagagcatggtggaatatggaacc
tgcatgtgcttagtcaagggcatcttctaccactgctccaatgacgacgaaggggattcc
tattcagataatccttgctcctgttcacaatcacactgctgctctagatacctgtgtatg
ggagccatgtctttatttttaccttgcttactctgttatcctcctgctaaaggatgcctg
aagctgtgcaggaggtgttatgactggatccatcgcccagggtgcagatgtaagaactcc
aacactgtctattgtaagctggagagctgcccctcccggggtcagggtaaaccatcatga

DBGET integrated database retrieval system