KEGG   Homo sapiens (human): 10253Help
Entry
10253             CDS       T01001                                 

Gene name
SPRY2, hSPRY2
Definition
sprouty homolog 2 (Drosophila)
Orthology
K17383  
protein sprouty homolog 2
Organism
hsa  Homo sapiens (human)
Pathway
Jak-STAT signaling pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    10253 (SPRY2)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    10253 (SPRY2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q31.1
AA seq 315 aa AA seqDB search
MEARAQSGNGSQPLLQTPRDGGRQRGEPDPRDALTQQVHVLSLDQIRAIRNTNEYTEGPT
VVPRPGLKPAPRPSTQHKHERLHGLPEHRQPPRLQHSQVHSSARAPLSRSISTVSSGSRS
STRTSTSSSSSEQRLLGSSFSSGPVADGIIRVQPKSELKPGELKPLSKEDLGLHAYRCED
CGKCKCKECTYPRPLPSDWICDKQCLCSAQNVIDYGTCVCCVKGLFYHCSNDDEDNCADN
PCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQGCYDRVNRPGCRCKNSNTVC
CKVPTVPPRNFEKPT
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggaggccagagctcagagtggcaacgggtcgcagcccttgctgcagacgccccgtgac
ggtggcagacagcgtggggagcccgaccccagagacgccctcacccagcaggtacatgtc
ttgtctctggatcagatcagagccatccgaaacaccaatgagtacacagaggggcctact
gtcgtcccaagacctgggctcaagcctgctcctcgcccctccactcagcacaaacacgag
agactccacggtctgcctgagcaccgccagcctcctaggctccagcactcgcaggtccat
tcttctgcacgagcccctctgtccagatccataagcacggtcagctcagggtcgcggagc
agtacgaggacaagtaccagcagcagctcctctgaacagagactgctaggatcatccttc
tcctccgggcctgttgctgatggcataatccgggtgcaacccaaatctgagctcaagcca
ggtgagcttaagccactgagcaaggaagatttgggcctgcacgcctacaggtgtgaggac
tgtggcaagtgcaaatgtaaggagtgcacctacccaaggcctctgccatcagactggatc
tgcgacaagcagtgcctttgctcggcccagaacgtgattgactatgggacttgtgtatgc
tgtgtgaaaggtctcttctatcactgttctaatgatgatgaggacaactgtgctgacaac
ccatgttcttgcagccagtctcactgttgtacacgatggtcagccatgggtgtcatgtcc
ctctttttgccttgtttatggtgttaccttccagccaagggttgccttaaattgtgccag
gggtgttatgaccgggttaacaggcctggttgccgctgtaaaaactcaaacacagtttgc
tgcaaagttcccactgtcccccctaggaactttgaaaaaccaacatag

DBGET integrated database retrieval system