KEGG   Homo sapiens (human): 10257Help
Entry
10257             CDS       T01001                                 

Gene name
ABCC4, MOAT-B, MOATB, MRP4
Definition
(RefSeq) ATP binding cassette subfamily C member 4 (EC:3.6.3.49)
  KO
K05673  
ATP-binding cassette, subfamily C (CFTR/MRP), member 4
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
cAMP signaling pathway
Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    10257 (ABCC4)
  Signal transduction
   04024 cAMP signaling pathway
    10257 (ABCC4)
 Organismal Systems
  Digestive system
   04976 Bile secretion
    10257 (ABCC4)
Transporters [BR:hsa02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   Others
    10257 (ABCC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q32
AA seq 1325 aa AA seqDB search
MLPVYQEVKPNPLQDANLCSRVFFWWLNPLFKIGHKRRLEEDDMYSVLPEDRSQHLGEEL
QGFWDKEVLRAENDAQKPSLTRAIIKCYWKSYLVLGIFTLIEESAKVIQPIFLGKIINYF
ENYDPMDSVALNTAYAYATVLTFCTLILAILHHLYFYHVQCAGMRLRVAMCHMIYRKALR
LSNMAMGKTTTGQIVNLLSNDVNKFDQVTVFLHFLWAGPLQAIAVTALLWMEIGISCLAG
MAVLIILLPLQSCFGKLFSSLRSKTATFTDARIRTMNEVITGIRIIKMYAWEKSFSNLIT
NLRKKEISKILRSSCLRGMNLASFFSASKIIVFVTFTTYVLLGSVITASRVFVAVTLYGA
VRLTVTLFFPSAIERVSEAIVSIRRIQTFLLLDEISQRNRQLPSDGKKMVHVQDFTAFWD
KASETPTLQGLSFTVRPGELLAVVGPVGAGKSSLLSAVLGELAPSHGLVSVHGRIAYVSQ
QPWVFSGTLRSNILFGKKYEKERYEKVIKACALKKDLQLLEDGDLTVIGDRGTTLSGGQK
ARVNLARAVYQDADIYLLDDPLSAVDAEVSRHLFELCICQILHEKITILVTHQLQYLKAA
SQILILKDGKMVQKGTYTEFLKSGIDFGSLLKKDNEESEQPPVPGTPTLRNRTFSESSVW
SQQSSRPSLKDGALESQDTENVPVTLSEENRSEGKVGFQAYKNYFRAGAHWIVFIFLILL
NTAAQVAYVLQDWWLSYWANKQSMLNVTVNGGGNVTEKLDLNWYLGIYSGLTVATVLFGI
ARSLLVFYVLVNSSQTLHNKMFESILKAPVLFFDRNPIGRILNRFSKDIGHLDDLLPLTF
LDFIQTLLQVVGVVSVAVAVIPWIAIPLVPLGIIFIFLRRYFLETSRDVKRLESTTRSPV
FSHLSSSLQGLWTIRAYKAEERCQELFDAHQDLHSEAWFLFLTTSRWFAVRLDAICAMFV
IIVAFGSLILAKTLDAGQVGLALSYALTLMGMFQWCVRQSAEVENMMISVERVIEYTDLE
KEAPWEYQKRPPPAWPHEGVIIFDNVNFMYSPGGPLVLKHLTALIKSQEKVGIVGRTGAG
KSSLISALFRLSEPEGKIWIDKILTTEIGLHDLRKKMSIIPQEPVLFTGTMRKNLDPFNE
HTDEELWNALQEVQLKETIEDLPGKMDTELAESGSNFSVGQRQLVCLARAILRKNQILII
DEATANVDPRTDELIQKKIREKFAHCTVLTIAHRLNTIIDSDKIMVLDSGRLKEYDEPYV
LLQNKESLFYKMVQQLGKAEAAALTETAKQVYFKRNYPHIGHTDHMVTNTSNGQPSTLTI
FETAL
NT seq 3978 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccgtgtaccaggaggtgaagcccaacccgctgcaggacgcgaacctctgctca
cgcgtgttcttctggtggctcaatcccttgtttaaaattggccataaacggagattagag
gaagatgatatgtattcagtgctgccagaagaccgctcacagcaccttggagaggagttg
caagggttctgggataaagaagttttaagagctgagaatgacgcacagaagccttcttta
acaagagcaatcataaagtgttactggaaatcttatttagttttgggaatttttacgtta
attgaggaaagtgccaaagtaatccagcccatatttttgggaaaaattattaattatttt
gaaaattatgatcccatggattctgtggctttgaacacagcgtacgcctatgccacggtg
ctgactttttgcacgctcattttggctatactgcatcacttatatttttatcacgttcag
tgtgctgggatgaggttacgagtagccatgtgccatatgatttatcggaaggcacttcgt
cttagtaacatggccatggggaagacaaccacaggccagatagtcaatctgctgtccaat
gatgtgaacaagtttgatcaggtgacagtgttcttacacttcctgtgggcaggaccactg
caggcgattgcagtgactgccctactctggatggagataggaatatcgtgccttgctggg
atggcagttctaatcattctcctgcccttgcaaagctgttttgggaagttgttctcatca
ctgaggagtaaaactgcaactttcacggatgccaggatcaggaccatgaatgaagttata
actggtataaggataataaaaatgtacgcctgggaaaagtcattttcaaatcttattacc
aatttgagaaagaaggagatttccaagattctgagaagttcctgcctcagagggatgaat
ttggcttcatttttcagtgcaagcaaaatcatcgtgtttgtgaccttcaccacctacgtg
ctcctcggcagtgtgatcacagccagccgcgtgttcgtggcagtgacgctgtatggggct
gtgcggctgacggttaccctcttcttcccctcagccattgagagggtgtcagaggcaatc
gtcagcatccgaagaatccagacctttttgctacttgatgagatatcacagcgcaaccgt
cagctgccgtcagatggtaaaaagatggtgcatgtgcaggattttactgctttttgggat
aaggcatcagagaccccaactctacaaggcctttcctttactgtcagacctggcgaattg
ttagctgtggtcggccccgtgggagcagggaagtcatcactgttaagtgccgtgctcggg
gaattggccccaagtcacgggctggtcagcgtgcatggaagaattgcctatgtgtctcag
cagccctgggtgttctcgggaactctgaggagtaatattttatttgggaagaaatacgaa
aaggaacgatatgaaaaagtcataaaggcttgtgctctgaaaaaggatttacagctgttg
gaggatggtgatctgactgtgataggagatcggggaaccacgctgagtggagggcagaaa
gcacgggtaaaccttgcaagagcagtgtatcaagatgctgacatctatctcctggacgat
cctctcagtgcagtagatgcggaagttagcagacacttgttcgaactgtgtatttgtcaa
attttgcatgagaagatcacaattttagtgactcatcagttgcagtacctcaaagctgca
agtcagattctgatattgaaagatggtaaaatggtgcagaaggggacttacactgagttc
ctaaaatctggtatagattttggctcccttttaaagaaggataatgaggaaagtgaacaa
cctccagttccaggaactcccacactaaggaatcgtaccttctcagagtcttcggtttgg
tctcaacaatcttctagaccctccttgaaagatggtgctctggagagccaagatacagag
aatgtcccagttacactatcagaggagaaccgttctgaaggaaaagttggttttcaggcc
tataagaattacttcagagctggtgctcactggattgtcttcattttccttattctccta
aacactgcagctcaggttgcctatgtgcttcaagattggtggctttcatactgggcaaac
aaacaaagtatgctaaatgtcactgtaaatggaggaggaaatgtaaccgagaagctagat
cttaactggtacttaggaatttattcaggtttaactgtagctaccgttctttttggcata
gcaagatctctattggtattctacgtccttgttaactcttcacaaactttgcacaacaaa
atgtttgagtcaattctgaaagctccggtattattctttgatagaaatccaataggaaga
attttaaatcgtttctccaaagacattggacacttggatgatttgctgccgctgacgttt
ttagatttcatccagacattgctacaagtggttggtgtggtctctgtggctgtggccgtg
attccttggatcgcaatacccttggttccccttggaatcattttcatttttcttcggcga
tattttttggaaacgtcaagagatgtgaagcgcctggaatctacaactcggagtccagtg
ttttcccacttatcatcttctctccaggggctctggaccatccgggcatacaaagcagaa
gagaggtgtcaggaactgtttgatgcacaccaggatttacattcagaggcttggttcttg
tttttgacaacgtcccgctggtttgccgtccgtctggatgccatctgtgccatgtttgtc
atcatcgttgcctttgggtccctgattctggcaaaaactctggatgccgggcaggttggt
ttggcactgtcctatgccctcacgctcatggggatgtttcagtggtgtgttcgacaaagt
gctgaagttgagaatatgatgatctcagtagaaagggtcattgaatacacagaccttgaa
aaagaagcaccttgggaatatcagaaacgcccaccaccagcctggccccatgaaggagtg
ataatctttgacaatgtgaacttcatgtacagtccaggtgggcctctggtactgaagcat
ctgacagcactcattaaatcacaagaaaaggttggcattgtgggaagaaccggagctgga
aaaagttccctcatctcagccctttttagattgtcagaacccgaaggtaaaatttggatt
gataagatcttgacaactgaaattggacttcacgatttaaggaagaagatgtcaatcata
cctcaggaacctgttttgttcactggaacaatgaggaaaaacctggatccctttaatgag
cacacggatgaggaactgtggaatgccttacaagaggtacaacttaaagaaaccattgaa
gatcttcctggtaaaatggatactgaattagcagaatcaggatccaattttagtgttgga
caaagacaactggtgtgccttgccagggcaattctcaggaaaaatcagatattgattatt
gatgaagcgacggcaaatgtggatccaagaactgatgagttaatacaaaaaaaaatccgg
gagaaatttgcccactgcaccgtgctaaccattgcacacagattgaacaccattattgac
agcgacaagataatggttttagattcaggaagactgaaagaatatgatgagccgtatgtt
ttgctgcaaaataaagagagcctattttacaagatggtgcaacaactgggcaaggcagaa
gccgctgccctcactgaaacagcaaaacaggtatacttcaaaagaaattatccacatatt
ggtcacactgaccacatggttacaaacacttccaatggacagccctcgaccttaactatt
ttcgagacagcactgtga

DBGET integrated database retrieval system