KEGG   Homo sapiens (human): 10257Help
Entry
10257             CDS       T01001                                 

Gene name
ABCC4, MOAT-B, MOATB, MRP4
Definition
(RefSeq) ATP binding cassette subfamily C member 4 (EC:3.6.3.49)
  KO
K05673  
ATP-binding cassette, subfamily C (CFTR/MRP), member 4
Organism
hsa  Homo sapiens (human)
Pathway
Antifolate resistance
ABC transporters
cAMP signaling pathway
Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    10257 (ABCC4)
  Signal transduction
   04024 cAMP signaling pathway
    10257 (ABCC4)
 Organismal Systems
  Digestive system
   04976 Bile secretion
    10257 (ABCC4)
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    10257 (ABCC4)
Transporters [BR:hsa02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    10257 (ABCC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q32
AA seq 1325 aa AA seqDB search
MLPVYQEVKPNPLQDANLCSRVFFWWLNPLFKIGHKRRLEEDDMYSVLPEDRSQHLGEEL
QGFWDKEVLRAENDAQKPSLTRAIIKCYWKSYLVLGIFTLIEESAKVIQPIFLGKIINYF
ENYDPMDSVALNTAYAYATVLTFCTLILAILHHLYFYHVQCAGMRLRVAMCHMIYRKALR
LSNMAMGKTTTGQIVNLLSNDVNKFDQVTVFLHFLWAGPLQAIAVTALLWMEIGISCLAG
MAVLIILLPLQSCFGKLFSSLRSKTATFTDARIRTMNEVITGIRIIKMYAWEKSFSNLIT
NLRKKEISKILRSSCLRGMNLASFFSASKIIVFVTFTTYVLLGSVITASRVFVAVTLYGA
VRLTVTLFFPSAIERVSEAIVSIRRIQTFLLLDEISQRNRQLPSDGKKMVHVQDFTAFWD
KASETPTLQGLSFTVRPGELLAVVGPVGAGKSSLLSAVLGELAPSHGLVSVHGRIAYVSQ
QPWVFSGTLRSNILFGKKYEKERYEKVIKACALKKDLQLLEDGDLTVIGDRGTTLSGGQK
ARVNLARAVYQDADIYLLDDPLSAVDAEVSRHLFELCICQILHEKITILVTHQLQYLKAA
SQILILKDGKMVQKGTYTEFLKSGIDFGSLLKKDNEESEQPPVPGTPTLRNRTFSESSVW
SQQSSRPSLKDGALESQDTENVPVTLSEENRSEGKVGFQAYKNYFRAGAHWIVFIFLILL
NTAAQVAYVLQDWWLSYWANKQSMLNVTVNGGGNVTEKLDLNWYLGIYSGLTVATVLFGI
ARSLLVFYVLVNSSQTLHNKMFESILKAPVLFFDRNPIGRILNRFSKDIGHLDDLLPLTF
LDFIQTLLQVVGVVSVAVAVIPWIAIPLVPLGIIFIFLRRYFLETSRDVKRLESTTRSPV
FSHLSSSLQGLWTIRAYKAEERCQELFDAHQDLHSEAWFLFLTTSRWFAVRLDAICAMFV
IIVAFGSLILAKTLDAGQVGLALSYALTLMGMFQWCVRQSAEVENMMISVERVIEYTDLE
KEAPWEYQKRPPPAWPHEGVIIFDNVNFMYSPGGPLVLKHLTALIKSQEKVGIVGRTGAG
KSSLISALFRLSEPEGKIWIDKILTTEIGLHDLRKKMSIIPQEPVLFTGTMRKNLDPFNE
HTDEELWNALQEVQLKETIEDLPGKMDTELAESGSNFSVGQRQLVCLARAILRKNQILII
DEATANVDPRTDELIQKKIREKFAHCTVLTIAHRLNTIIDSDKIMVLDSGRLKEYDEPYV
LLQNKESLFYKMVQQLGKAEAAALTETAKQVYFKRNYPHIGHTDHMVTNTSNGQPSTLTI
FETAL
NT seq 3978 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccgtgtaccaggaggtgaagcccaacccgctgcaggacgcgaacctctgctca
cgcgtgttcttctggtggctcaatcccttgtttaaaattggccataaacggagattagag
gaagatgatatgtattcagtgctgccagaagaccgctcacagcaccttggagaggagttg
caagggttctgggataaagaagttttaagagctgagaatgacgcacagaagccttcttta
acaagagcaatcataaagtgttactggaaatcttatttagttttgggaatttttacgtta
attgaggaaagtgccaaagtaatccagcccatatttttgggaaaaattattaattatttt
gaaaattatgatcccatggattctgtggctttgaacacagcgtacgcctatgccacggtg
ctgactttttgcacgctcattttggctatactgcatcacttatatttttatcacgttcag
tgtgctgggatgaggttacgagtagccatgtgccatatgatttatcggaaggcacttcgt
cttagtaacatggccatggggaagacaaccacaggccagatagtcaatctgctgtccaat
gatgtgaacaagtttgatcaggtgacagtgttcttacacttcctgtgggcaggaccactg
caggcgattgcagtgactgccctactctggatggagataggaatatcgtgccttgctggg
atggcagttctaatcattctcctgcccttgcaaagctgttttgggaagttgttctcatca
ctgaggagtaaaactgcaactttcacggatgccaggatcaggaccatgaatgaagttata
actggtataaggataataaaaatgtacgcctgggaaaagtcattttcaaatcttattacc
aatttgagaaagaaggagatttccaagattctgagaagttcctgcctcagagggatgaat
ttggcttcatttttcagtgcaagcaaaatcatcgtgtttgtgaccttcaccacctacgtg
ctcctcggcagtgtgatcacagccagccgcgtgttcgtggcagtgacgctgtatggggct
gtgcggctgacggttaccctcttcttcccctcagccattgagagggtgtcagaggcaatc
gtcagcatccgaagaatccagacctttttgctacttgatgagatatcacagcgcaaccgt
cagctgccgtcagatggtaaaaagatggtgcatgtgcaggattttactgctttttgggat
aaggcatcagagaccccaactctacaaggcctttcctttactgtcagacctggcgaattg
ttagctgtggtcggccccgtgggagcagggaagtcatcactgttaagtgccgtgctcggg
gaattggccccaagtcacgggctggtcagcgtgcatggaagaattgcctatgtgtctcag
cagccctgggtgttctcgggaactctgaggagtaatattttatttgggaagaaatacgaa
aaggaacgatatgaaaaagtcataaaggcttgtgctctgaaaaaggatttacagctgttg
gaggatggtgatctgactgtgataggagatcggggaaccacgctgagtggagggcagaaa
gcacgggtaaaccttgcaagagcagtgtatcaagatgctgacatctatctcctggacgat
cctctcagtgcagtagatgcggaagttagcagacacttgttcgaactgtgtatttgtcaa
attttgcatgagaagatcacaattttagtgactcatcagttgcagtacctcaaagctgca
agtcagattctgatattgaaagatggtaaaatggtgcagaaggggacttacactgagttc
ctaaaatctggtatagattttggctcccttttaaagaaggataatgaggaaagtgaacaa
cctccagttccaggaactcccacactaaggaatcgtaccttctcagagtcttcggtttgg
tctcaacaatcttctagaccctccttgaaagatggtgctctggagagccaagatacagag
aatgtcccagttacactatcagaggagaaccgttctgaaggaaaagttggttttcaggcc
tataagaattacttcagagctggtgctcactggattgtcttcattttccttattctccta
aacactgcagctcaggttgcctatgtgcttcaagattggtggctttcatactgggcaaac
aaacaaagtatgctaaatgtcactgtaaatggaggaggaaatgtaaccgagaagctagat
cttaactggtacttaggaatttattcaggtttaactgtagctaccgttctttttggcata
gcaagatctctattggtattctacgtccttgttaactcttcacaaactttgcacaacaaa
atgtttgagtcaattctgaaagctccggtattattctttgatagaaatccaataggaaga
attttaaatcgtttctccaaagacattggacacttggatgatttgctgccgctgacgttt
ttagatttcatccagacattgctacaagtggttggtgtggtctctgtggctgtggccgtg
attccttggatcgcaatacccttggttccccttggaatcattttcatttttcttcggcga
tattttttggaaacgtcaagagatgtgaagcgcctggaatctacaactcggagtccagtg
ttttcccacttatcatcttctctccaggggctctggaccatccgggcatacaaagcagaa
gagaggtgtcaggaactgtttgatgcacaccaggatttacattcagaggcttggttcttg
tttttgacaacgtcccgctggtttgccgtccgtctggatgccatctgtgccatgtttgtc
atcatcgttgcctttgggtccctgattctggcaaaaactctggatgccgggcaggttggt
ttggcactgtcctatgccctcacgctcatggggatgtttcagtggtgtgttcgacaaagt
gctgaagttgagaatatgatgatctcagtagaaagggtcattgaatacacagaccttgaa
aaagaagcaccttgggaatatcagaaacgcccaccaccagcctggccccatgaaggagtg
ataatctttgacaatgtgaacttcatgtacagtccaggtgggcctctggtactgaagcat
ctgacagcactcattaaatcacaagaaaaggttggcattgtgggaagaaccggagctgga
aaaagttccctcatctcagccctttttagattgtcagaacccgaaggtaaaatttggatt
gataagatcttgacaactgaaattggacttcacgatttaaggaagaagatgtcaatcata
cctcaggaacctgttttgttcactggaacaatgaggaaaaacctggatccctttaatgag
cacacggatgaggaactgtggaatgccttacaagaggtacaacttaaagaaaccattgaa
gatcttcctggtaaaatggatactgaattagcagaatcaggatccaattttagtgttgga
caaagacaactggtgtgccttgccagggcaattctcaggaaaaatcagatattgattatt
gatgaagcgacggcaaatgtggatccaagaactgatgagttaatacaaaaaaaaatccgg
gagaaatttgcccactgcaccgtgctaaccattgcacacagattgaacaccattattgac
agcgacaagataatggttttagattcaggaagactgaaagaatatgatgagccgtatgtt
ttgctgcaaaataaagagagcctattttacaagatggtgcaacaactgggcaaggcagaa
gccgctgccctcactgaaacagcaaaacaggtatacttcaaaagaaattatccacatatt
ggtcacactgaccacatggttacaaacacttccaatggacagccctcgaccttaactatt
ttcgagacagcactgtga

DBGET integrated database retrieval system