KEGG   Homo sapiens (human): 10267Help
Entry
10267             CDS       T01001                                 

Gene name
RAMP1
Definition
receptor (G protein-coupled) activity modifying protein 1
Orthology
K08447  
receptor activity modifying protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Vascular smooth muscle contraction
Class
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:hsa04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q36-q37.1
AA seq 148 aa AA seqDB search
MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWG
RTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILY
PFIVVPITVTLLVTALVVWQSKRTEGIV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggcccgggccctgtgccgcctcccgcggcgcggcctctggctgctcctggcccatcac
ctcttcatgaccactgcctgccaggaggctaactacggtgccctcctccgggagctctgc
ctcacccagttccaggtagacatggaggccgtcggggagacgctgtggtgtgactggggc
aggaccatcaggagctacagggagctggccgactgcacctggcacatggcggagaagctg
ggctgcttctggcccaatgcagaggtggacaggttcttcctggcagtgcatggccgctac
ttcaggagctgccccatctcaggcagggccgtgcgggacccgcccggcagcatcctctac
cccttcatcgtggtccccatcacggtgaccctgctggtgacggcactggtggtctggcag
agcaagcgcactgagggcattgtgtag

DBGET integrated database retrieval system