KEGG   Homo sapiens (human): 10268Help
Entry
10268             CDS       T01001                                 

Gene name
RAMP3
Definition
receptor (G protein-coupled) activity modifying protein 3
Orthology
K08449  
receptor activity modifying protein 3
Organism
hsa  Homo sapiens (human)
Pathway
Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    10268 (RAMP3)
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Other
   Putative / unclassified Class B GPCRs
    10268 (RAMP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7p13-p12
AA seq 148 aa AA seqDB search
METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLS
EFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLI
PLIVIPVVLTVAMAGLVVWRSKRTDTLL
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggagactggagcgctgcggcgcccgcaacttctcccgttgctgctgctgctctgcggt
gggtgtcccagagcaggcggctgcaacgagacaggcatgttggagaggctgcccctgtgt
gggaaggctttcgcagacatgatgggcaaggtggacgtctggaagtggtgcaacctgtcc
gagttcatcgtgtactatgagagtttcaccaactgcaccgagatggaggccaatgtcgtg
ggctgctactggcccaaccccctggcccagggcttcatcaccggcatccacaggcagttc
ttctccaactgcaccgtggacagggtccacttggaggaccccccagacgaggttctcatc
ccgctgatcgttatacccgtcgttctgactgtcgccatggctggcctggtggtgtggcgc
agcaaacgcaccgacacgctgctgtga

DBGET integrated database retrieval system