KEGG   Homo sapiens (human): 10273Help
Entry
10273             CDS       T01001                                 

Gene name
STUB1, CHIP, HSPABP2, NY-CO-7, SCAR16, SDCCAG7, UBOX1
Definition
STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase
Orthology
K09561  
STIP1 homology and U-box containing protein 1 [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Disease
H00063  
Spinocerebellar ataxia (SCA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10273 (STUB1)
   04120 Ubiquitin mediated proteolysis
    10273 (STUB1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     10273 (STUB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.3
AA seq 231 aa AA seqDB search
MQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFG
DDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSH
VRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITY
DRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagcacgagcaggccctggccgactgccggcgcgccctggagctggacgggcag
tctgtgaaggcgcacttcttcctggggcagtgccagctggagatggagagctatgatgag
gccatcgccaatctgcagcgagcttacagcctggccaaggagcagcggctgaacttcggg
gacgacatccccagcgctcttcgaatcgcgaagaagaagcgctggaacagcattgaggag
cggcgcatccaccaggagagcgagctgcactcctacctctccaggctcattgccgcggag
cgtgagagggagctggaagagtgccagcgaaaccacgagggtgatgaggacgacagccac
gtccgggcccagcaggcctgcattgaggccaagcacgacaagtacatggcggacatggac
gagcttttttctcaggtggatgagaagaggaagaagcgagacatccccgactacctgtgt
ggcaagatcagctttgagctgatgcgggagccgtgcatcacgcccagtggcatcacctac
gaccgcaaggacatcgaggagcacctgcagcgtgtgggtcattttgaccccgtgacccgg
agccccctgacccaggaacagctcatccccaacttggctatgaaggaggttattgacgca
ttcatctctgagaatggctgggtggaggactactga

DBGET integrated database retrieval system