KEGG   Homo sapiens (human): 10277Help
Entry
10277             CDS       T01001                                 

Gene name
UBE4B, E4, HDNB1, UBOX3, UFD2, UFD2A
Definition
ubiquitination factor E4B
Orthology
K10597  
ubiquitin conjugation factor E4 B [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10277 (UBE4B)
   04120 Ubiquitin mediated proteolysis
    10277 (UBE4B)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     10277 (UBE4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.3
AA seq 1302 aa AA seqDB search
MEELSADEIRRRRLARLAGGQTSQPTTPLTSPQRENPPGPPIAASAPGPSQSLGLNVHNM
TPATSPIGASGVAHRSQSSEGVSSLSSSPSNSLETQSQSLSRSQSMDIDGVSCEKSMSQV
DVDSGIENMEVDENDRREKRSLSDKEPSSGPEVSEEQALQLVCKIFRVSWKDRDRDVIFL
SSLSAQFKQNPKEVFSDFKDLIGQILMEVLMMSTQTRDENPFASLTATSQPIAAAARSPD
RNLLLNTGSNPGTSPMFCSVASFGASSLSSLYESSPAPTPSFWSSVPVMGPSLASPSRAA
SQLAVPSTPLSPHSAASGTAAGSQPSSPRYRPYTVTHPWASSGVSILSSSPSPPALASSP
QAVPASSSRQRPSSTGPPLPPASPSATSRRPSSLRISPSLGASGGASNWDSYSDHFTIET
CKETDMLNYLIECFDRVGIEEKKAPKMCSQPAVSQLLSNIRSQCISHTALVLQGSLTQPR
SLQQPSFLVPYMLCRNLPYGFIQELVRTTHQDEEVFKQIFIPILQGLALAAKECSLDSDY
FKYPLMALGELCETKFGKTHPVCNLVASLRLWLPKSLSPGCGRELQRLSYLGAFFSFSVF
AEDDVKVVEKYFSGPAITLENTRVVSQSLQHYLELGRQELFKILHSILLNGETREAALSY
MAAVVNANMKKAQMQTDDRLVSTDGFMLNFLWVLQQLSTKIKLETVDPTYIFHPRCRITL
PNDETRVNATMEDVNDWLTELYGDQPPFSEPKFPTECFFLTLHAHHLSILPSCRRYIRRL
RAIRELNRTVEDLKNNESQWKDSPLATRHREMLKRCKTQLKKLVRCKACADAGLLDESFL
RRCLNFYGLLIQLLLRILDPAYPDITLPLNSDVPKVFAALPEFYVEDVAEFLFFIVQYSP
QALYEPCTQDIVMFLVVMLCNQNYIRNPYLVAKLVEVMFMTNPAVQPRTQKFFEMIENHP
LSTKLLVPSLMKFYTDVEHTGATSEFYDKFTIRYHISTIFKSLWQNIAHHGTFMEEFNSG
KQFVRYINMLINDTTFLLDESLESLKRIHEVQEEMKNKEQWDQLPRDQQQARQSQLAQDE
RVSRSYLALATETVDMFHILTKQVQKPFLRPELGPRLAAMLNFNLQQLCGPKCRDLKVEN
PEKYGFEPKKLLDQLTDIYLQLDCARFAKAIADDQRSYSKELFEEVISKMRKAGIKSTIA
IEKFKLLAEKVEEIVAKNARAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILR
HLLNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNSDH
NT seq 3909 nt NT seq  +upstreamnt  +downstreamnt
atggaggagctgagcgctgatgagattcgacggaggcgccttgcacgacttgctggtgga
cagacctctcagccaaccaccccactcacctctccccagagggagaaccctccggggcct
cccatagcggcatcagccccaggaccctctcagagtcttggtctcaatgtccacaacatg
accccagctacctccccaataggtgcatcaggagtagcccatcgaagccagagcagtgaa
ggagtcagttctctcagcagctcgccctctaatagccttgaaacgcaatctcagtctctc
tcacgttcccagagcatggatatcgatggtgtctcatgtgagaaaagcatgtcccaggtg
gatgtggattcaggaattgaaaacatggaggttgatgaaaatgatcgaagagaaaagcgg
agcctcagtgataaggagccttcctcgggccctgaagtgtctgaagagcaggccttacag
ctggtctgtaagatcttccgtgtctcttggaaggaccgggacagagatgtcatctttctt
tcttctctttctgcacagtttaagcagaacccaaaagaagtattctccgattttaaggac
ttgattggccagattttaatggaagtgctaatgatgtccactcagaccagagatgaaaac
ccatttgccagtctgacagccacatcacagccaattgctgcagcagcacggtcaccagac
agaaatctcttgctaaacactggctccaatccaggaacaagccccatgttctgcagcgtg
gcttcctttggtgccagctctttgtctagcctctatgaaagtagtccggctcccactccc
agtttctggagctctgttcccgtgatgggcccgtctcttgcctcaccttcccgtgcagcc
agccagttggctgtgccttccactcccctcagtcctcacagtgcagcctctggaactgct
gcgggaagccagccttcatccccgcggtatcgcccctacactgtcactcacccatgggcg
tcctcaggcgtctccattctgtcgagctccccaagtccccctgccctcgccagtagcccc
caagcagtgcccgccagcagttccagacagaggcccagcagcacgggtccacccctacca
cccgcctcacccagtgccacgagcagacgcccctcctccctgaggatctctcctagtttg
ggagcctctggtggagcaagtaattgggattcctacagtgaccatttcaccattgaaacc
tgcaaagagacagatatgctgaactacctcatcgagtgtttcgaccgagttggaatagag
gaaaaaaaagcaccaaagatgtgcagccagccagcagtcagccagcttctgagcaacatc
cgctcacagtgcatatcccatactgctttagtactacaaggctccctaacacagcccagg
tccttgcagcagccgtccttcctagtgccgtatatgctgtgtaggaatctcccatatggc
ttcattcaggaactggtgagaaccactcaccaggatgaagaagtgttcaagcagatattt
atccccattttacaaggcctggctcttgctgccaaagagtgctccctcgacagtgactac
tttaaataccccctcatggcactaggtgagctctgtgaaaccaagtttgggaagacacac
cctgtgtgcaatttggttgcttctttgcggttgtggttgccgaaatccttaagtcctggc
tgtgggcgggagctgcagagactctcttacttaggggctttctttagcttctcagtcttt
gcagaagatgatgttaaagtggttgaaaaatacttctcagggcctgccattaccctggaa
aacactcgtgtggttagccaatcattgcagcattacttagagctcggaaggcaagagctt
tttaagattctgcatagtattttgttaaatggcgaaacccgtgaggctgctctcagttac
atggcggctgtcgtcaatgccaatatgaagaaagcacagatgcagacagatgatagattg
gtgtctacagatggatttatgctgaatttcctttgggtactgcagcagctaagtacaaaa
atcaagttagaaacagttgatcccacgtatatttttcacccaagatgtcggattactctt
cccaatgatgagacgcgtgtgaatgcaacgatggaagatgtgaatgactggctgactgaa
ctctatggcgatcagcctccattttctgagccgaaattccctacggagtgcttctttctc
accctgcatgctcaccacctctctattctgcctagttgccgtcgctatatccgcagactc
cgggctatccgggagctcaatagaactgtagaagatttgaaaaataatgaaagccaatgg
aaagattccccactggcaactagacaccgcgaaatgctgaagcgctgtaaaactcagctt
aagaaactggtacggtgcaaggcctgtgctgatgctggcctacttgacgagagcttcctg
agaagatgtctgaatttttatggccttctcattcagctgctgctccgcatcctggacccc
gcatatcccgatataacactgcctttaaattcagatgtccccaaggtatttgcagcgttg
cctgagttttatgtagaagatgttgcagaatttttattttttattgtacaatactctccc
caggcgctttatgagccctgtactcaggatattgtgatgttccttgttgtgatgttgtgc
aaccagaactacatccgaaacccatatttggtggccaaactggtagaagtcatgtttatg
accaaccctgctgttcagccacgaacccagaagttttttgaaatgattgagaaccatcct
ctctccaccaagttgttggtaccttccctgatgaagttttatacagatgttgagcatacc
ggagccaccagtgagttttatgacaagttcacaattcgctatcatattagcaccattttt
aaaagcctttggcaaaacatagctcaccatggcacctttatggaggagttcaactccggg
aagcagtttgttcgctatataaacatgttgataaacgacacgacgtttttgctcgatgaa
agtctggagtctctgaagcgaatccatgaagtgcaggaagagatgaagaacaaagaacag
tgggaccagttgccccgggatcagcagcaggctcgtcagtctcagcttgctcaggatgag
cgtgtgtcccgctcttacctcgccctggccaccgaaaccgtggacatgttccacatcctc
acgaagcaggtccagaagcccttcctcagaccggagcttggaccccgattggctgcaatg
ctgaactttaatcttcagcaactttgtggccccaagtgccgtgacctgaaagttgaaaac
cctgagaaatacggctttgaaccaaagaagctgttggaccaactgacggatatttactta
cagctggactgtgctcggttcgcgaaagccattgctgacgaccagagatcctacagtaag
gaattgtttgaagaagttatttcaaagatgcggaaggcagggatcaaatccacaatagca
atagaaaaatttaagctgctcgccgagaaagtggaggagatagtggccaagaacgcacgc
gcagaaatcgactacagcgacgctcctgatgagttcagagaccctctgatggacaccctc
atgacagaccccgtgcggctgccctctggcaccatcatggaccgctccatcatcctgcgg
cacctgctcaactcccccacggaccccttcaaccggcagacgctgacagagagcatgctg
gaaccagtgccagaactgaaagagcagattcaggcgtggatgagagagaaacagaacagc
gatcactaa

DBGET integrated database retrieval system