KEGG   Homo sapiens (human): 1028Help
Entry
1028              CDS       T01001                                 

Gene name
CDKN1C, BWCR, BWS, KIP2, WBS, p57, p57Kip2
Definition
cyclin-dependent kinase inhibitor 1C (p57, Kip2)
Orthology
K09993  
cyclin-dependent kinase inhibitor 1C
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Disease
H00033  
Adrenal carcinoma
H00713  
Beckwith-Wiedemann syndrome
Class
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.5
AA seq 316 aa AA seqDB search
MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNR
WDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLE
PAAESLDGLEEAPEQLPSVPVPAPASTPPPVPVLAPAPAPAPAPVAAPVAAPVAVAVLAP
APAPAPAPAPAPAPVAAPAPAPAPAPAPAPAPAPAPDAAPQESAEQGANQGQRGQEPLAD
QLHSGISGRPAAGTAAASANGAAIKKLSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSA
APGVGSVEQTPRKRLR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgcgtccctccgcagcacatccacgatggagcgtcttgtcgcccgtgggacc
ttcccagtactagtgcgcaccagcgcctgccgcagcctcttcgggccggtggaccacgag
gagctgagccgcgagctgcaggcccgcctggccgagctgaacgccgaggaccagaaccgc
tgggattacgacttccagcaggacatgccgctgcggggccctggacgcctgcagtggacc
gaagtggacagcgactcggtgcccgcgttctaccgcgagacggtgcaggtggggcgctgc
cgcctgctgctggcgccgcggcccgtcgcggtcgcggtggctgtcagcccgcccctcgag
ccggccgctgagtccctcgacggcctcgaggaggcgccggagcagctgcctagtgtcccg
gtcccggccccggcgtccaccccgcccccagtcccggtcctggctccagccccggccccg
gctccggctccggtcgcggctccggtcgcggctccggtcgcggtcgcggtcctggccccg
gccccggccccggctccggctccggctccggccccggctccagtcgcggccccggcccca
gccccggccccggccccggccccggcccccgccccggccccggccccggacgcggcgcct
caagagagcgccgagcagggcgcgaaccaggggcagcgcggccaggagcctctcgctgac
cagctgcactcggggatttcgggacgtcccgcggccggcaccgcggccgccagcgccaac
ggcgcggcgatcaagaagctgtccgggcctctgatctccgatttcttcgccaagcgcaag
agatcagcgcctgagaagtcgtcgggcgatgtccccgcgccgtgtccctctccaagcgcc
gcccctggcgtgggctcggtggagcagaccccgcgcaagaggctgcggtga

DBGET integrated database retrieval system