KEGG   Homo sapiens (human): 10280Help
Entry
10280             CDS       T01001                                 

Gene name
SIGMAR1, ALS16, DSMA2, OPRS1, SIG-1R, SR-BP, SR-BP1, SRBP, hSigmaR1, sigma1R
Definition
(RefSeq) sigma non-opioid intracellular receptor 1
  KO
K20719  
sigma non-opioid intracellular receptor
Organism
hsa  Homo sapiens (human)
Drug target
Dextromethorphan (DG01078): 
Dextromethorphan, combinations: 
Igmesine hydrochloride: 
Opipramol (DG00930): 
Remoxipride (DG00902): 
Rimcazole hydrochloride: 
Tiospirone hydrochloride: 
Brite
Transporters [BR:hsa02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   10280 (SIGMAR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9p13.3
AA seq 223 aa AA seqDB search
MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgggccgtgggccggcggtgggcgtgggccgcgctgctcctggctgtcgcagcg
gtgctgacccaggtcgtctggctctggctgggtacgcagagcttcgtcttccagcgcgaa
gagatagcgcagttggcgcggcagtacgctgggctggaccacgagctggccttctctcgt
ctgatcgtggagctgcggcggctgcacccaggccacgtgctgcccgacgaggagctgcag
tgggtgttcgtgaatgcgggtggctggatgggcgccatgtgccttctgcacgcctcgctg
tccgagtatgtgctgctcttcggcaccgccttgggctcccgcggccactcggggcgctac
tgggctgagatctcggataccatcatctctggcaccttccaccagtggagagagggcacc
accaaaagtgaggtcttctacccaggggagacggtagtacacgggcctggtgaggcaaca
gctgtggagtgggggccaaacacatggatggtggagtacggccggggcgtcatcccatcc
accctggccttcgcgctggccgacactgtcttcagcacccaggacttcctcaccctcttc
tatactcttcgctcctatgctcggggcctccggcttgagctcaccacctacctctttggc
caggacccttga

DBGET integrated database retrieval system