KEGG   Homo sapiens (human): 10282Help
Entry
10282             CDS       T01001                                 

Gene name
BET1, HBET1
Definition
(RefSeq) Bet1 golgi vesicular membrane trafficking protein
  KO
K08504  
blocked early in transport 1
Organism
hsa  Homo sapiens (human)
Pathway
SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    10282 (BET1)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNAP-25[C] (Qc)
   Bet1
    10282 (BET1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
O15155(Tdark)
UniProt: 
Position
7q21.3
AA seq 118 aa AA seqDB search
MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQ
NKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQTKLLCYMMLFSLFVFFIIYWIIKLR
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgtgcaggcctgggtgaaggagtacctcctggcaactatgggaactatggctat
gctaatagtgggtatagtgcctgtgaagaagaaaatgagaggctcactgaaagtctgaga
agcaaagtaactgctataaaatctctttccattgaaataggccatgaagttaaaacccag
aataaattattagctgaaatggattcacaatttgattccacaactggatttctaggtaaa
actatgggcaaactgaagattttatccagagggagccaaacaaagctgctgtgctatatg
atgctgttttctttatttgtcttttttatcatttattggattattaaactgaggtga

DBGET integrated database retrieval system