KEGG   Homo sapiens (human): 10282Help
Entry
10282             CDS       T01001                                 

Gene name
BET1, HBET1
Definition
Bet1 golgi vesicular membrane trafficking protein
Orthology
K08504  
blocked early in transport 1
Organism
hsa  Homo sapiens (human)
Pathway
SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    10282 (BET1)
SNAREs [BR:hsa04131]
 SNAP-25[C] (Qc)
  Bet1
   10282 (BET1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q21.1-q22
AA seq 118 aa AA seqDB search
MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQ
NKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQTKLLCYMMLFSLFVFFIIYWIIKLR
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgtgcaggcctgggtgaaggagtacctcctggcaactatgggaactatggctat
gctaatagtgggtatagtgcctgtgaagaagaaaatgagaggctcactgaaagtctgaga
agcaaagtaactgctataaaatctctttccattgaaataggccatgaagttaaaacccag
aataaattattagctgaaatggattcacaatttgattccacaactggatttctaggtaaa
actatgggcaaactgaagattttatccagagggagccaaacaaagctgctgtgctatatg
atgctgttttctttatttgtcttttttatcatttattggattattaaactgaggtga

DBGET integrated database retrieval system