KEGG   Homo sapiens (human): 10284Help
Entry
10284             CDS       T01001                                 

Gene name
SAP18, 2HOR0202, SAP18P
Definition
(RefSeq) Sin3A associated protein 18kDa
  KO
K14324  
histone deacetylase complex subunit SAP18
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
mRNA surveillance pathway
Module
Exon junction complex (EJC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    10284 (SAP18)
   03015 mRNA surveillance pathway
    10284 (SAP18)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     10284 (SAP18)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     10284 (SAP18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q12.11
AA seq 172 aa AA seqDB search
MLAAGVGGQGERLAGRRRKMAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHH
RMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGY
RVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPPSGRMRPY
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctgcaggggtcggaggtcagggcgagcgtctcgcaggccgtaggaggaagatg
gcggtggagtcgcgcgttacccaggaggaaattaagaaggagccagagaaaccgatcgac
cgcgagaagacatgcccactgttgctacgggtcttcaccaccaataacggccgccaccac
cgaatggacgagttctcccggggaaatgtaccgtccagcgagttgcagatctacacttgg
atggatgcaaccttgaaagaactgacaagcttagtaaaagaagtctacccagaagctaga
aagaagggcactcacttcaattttgcaatcgtttttacagatgttaaaagacctggctat
cgagttaaggagattggcagcaccatgtctggcagaaaggggactgatgattccatgacc
ctgcagtcgcagaagttccagataggagattacttggacatagcaattacccctccaaat
cgggcaccacctccttcagggcgcatgagaccatattaa

DBGET integrated database retrieval system