KEGG   Homo sapiens (human): 10285Help
Entry
10285             CDS       T01001                                 

Gene name
SMNDC1, SMNR, SPF30, TDRD16C
Definition
(RefSeq) survival motor neuron domain containing 1
  KO
K12839  
survival of motor neuron-related-splicing factor 30
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    10285 (SMNDC1)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    10285 (SMNDC1)
 Complex B
    10285 (SMNDC1)
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   Other proteins involved in snRNP biogenesis
    10285 (SMNDC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O75940(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
10q25.2
AA seq 238 aa AA seqDB search
MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLAS
SDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLL
NLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQ
FNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaggatttagcaaagcagctggcaagctacaaagctcagctccagcaagttgaa
gctgcattatctggaaatggagaaaatgaagatttgctaaaattgaagaaagatttacaa
gaagttatagaactaaccaaagaccttctgtcaactcaaccttctgagacgcttgcaagt
tcagacagttttgcttctactcaacctactcattcatggaaagtaggagacaagtgtatg
gcagtctggagtgaagatggacagtgttatgaagcggagattgaggagatagatgaagaa
aatggcaccgctgcaatcacctttgctggttatggcaatgctgaagtgactccactgttg
aacctcaagcctgtagaagaaggaaggaaggcaaaggaggacagtggcaacaaacccatg
tcaaaaaaagaaatgattgcccagcagcgtgaatataaaaagaagaaagctttgaaaaaa
gctcagagaataaaagaacttgagcaggaaagagaggaccagaaagtgaaatggcaacaa
ttcaacaacagagcctattctaaaaacaaaaaaggccaggtaaagaggagtatttttgct
tcacctgagagtgtgactggtaaagttggagtaggaacctgtggaattgctgataaacct
atgacacaatatcaagatacctctaaatacaatgtcaggcatttgatgcctcaataa

DBGET integrated database retrieval system