KEGG   Homo sapiens (human): 10289Help
Entry
10289             CDS       T01001                                 

Gene name
EIF1B, GC20
Definition
(RefSeq) eukaryotic translation initiation factor 1B
  KO
K03113  translation initiation factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    10289 (EIF1B)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-1
    10289 (EIF1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SUI1
Motif
Other DBs
NCBI-GeneID: 10289
NCBI-ProteinID: NP_005866
HGNC: 30792
Ensembl: ENSG00000114784
Vega: OTTHUMG00000131388
Pharos: O60739(Tbio)
UniProt: O60739 Q6FG85
Position
3p22.1
AA seq 113 aa AA seqDB search
MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLV
KAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgtccactatccagaacctccaatctttcgacccctttgctgatgcaactaagggtgac
gacttactcccggcagggactgaggattacattcatataagaatccagcaacggaacggc
agaaagacactgactactgttcagggcattgcagatgattatgacaaaaagaaacttgtg
aaagctttcaaaaagaaatttgcctgtaatggtactgtgattgaacatcctgaatacgga
gaggttattcagcttcaaggtgaccaaagaaaaaacatctgccagtttctcttggaggtt
ggcattgtaaaggaggaacagcttaaggttcatggattctaa

DBGET integrated database retrieval system