KEGG   Homo sapiens (human): 10293Help
Entry
10293             CDS       T01001                                 

Gene name
TRAIP, RNF206, SCKL9, TRIP
Definition
(RefSeq) TRAF interacting protein
  KO
K11985  
TRAF-interacting protein [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     10293 (TRAIP)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    10293 (TRAIP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.31
AA seq 469 aa AA seqDB search
MPIRALCTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRIQVGKRTIIN
KLFFDLAQEEENVLDAEFLKNELDNVRAQLSQKDKEKRDSQVIIDTLRDTLEERNATVVS
LQQALGKAEMLCSTLKKQMKYLEQQQDETKQAQEEARRLRSKMKTMEQIELLLQSQRPEV
EEMIRDMGVGQSAVEQLAVYCVSLKKEYENLKEARKASGEVADKLRKDLFSSRSKLQTVY
SELDQAKLELKSAQKDLQSADKEIMSLKKKLTMLQETLNLPPVASETVDRLVLESPAPVE
VNLKLRRPSFRDDIDLNATFDVDTPPARPSSSQHGYYEKLCLEKSHSPIQDVPKKICKGP
RKESQLSLGGQSCAGEPDEELVGAFPIFVRNAILGQKQPKRPRSESSCSKDVVRTGFDGL
GGRTKFIQPTDTVMIRPLPVKPKTKVKQRVRVKTVPSLFQAKLDTFLWS
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcctatccgtgctctgtgcactatctgctccgacttcttcgatcactcccgcgacgtg
gccgccatccactgcggccacaccttccacttgcagtgcctaattcagtggtttgagaca
gcaccaagtcggacctgcccacagtgccgaatccaggttggcaaaagaaccattatcaat
aagctcttctttgatcttgcccaggaggaggagaatgtcttggatgcagaattcttaaag
aatgaactggacaatgtcagagcccagctttcccagaaagacaaggagaaacgagacagc
caggtcatcatcgacactctgcgggatacgctggaagaacgcaatgctactgtggtatct
ctgcagcaggccttgggcaaggccgagatgctgtgctccacactgaaaaagcagatgaag
tacttagagcagcagcaggatgagaccaaacaagcacaagaggaggcccgccggctcagg
agcaagatgaagaccatggagcagattgagcttctactccagagccagcgccctgaggtg
gaggagatgatccgagacatgggtgtgggacagtcagcggtggaacagctggctgtgtac
tgtgtgtctctcaagaaagagtacgagaatctaaaagaggcacggaaggcctcaggggag
gtggctgacaagctgaggaaggatttgttttcctccagaagcaagttgcagacagtctac
tctgaattggatcaggccaagttagaactgaagtcagcccagaaggacttacagagtgct
gacaaggaaatcatgagcctgaaaaagaagctaacgatgctgcaggaaaccttgaacctg
ccaccagtggccagtgagactgtcgaccgcctggttttagagagcccagcccctgtggag
gtgaatctgaagctccgccggccatccttccgtgatgatattgatctcaatgctaccttt
gatgtggatactcccccagcccggccctccagctcccagcatggttactacgaaaaactt
tgcctagagaagtcacactccccaattcaggatgtccccaagaagatatgcaaaggcccc
aggaaggagtcccagctctcactgggtggccagagctgtgcaggagagccagatgaggaa
ctggttggtgccttccctatttttgtccggaatgccatcctaggccagaaacagcccaag
aggcccaggtcagagtcctcttgcagcaaagatgtggtaaggacaggcttcgatgggctc
ggtggccggacaaaattcatccagcctactgacacagtcatgatccgcccattgcctgtt
aagcccaagaccaaggttaagcagagggtgagggtgaagacagtgccttctctcttccag
gccaagctggacaccttcctgtggtcgtga

DBGET integrated database retrieval system