KEGG   Homo sapiens (human): 10295Help
Entry
10295             CDS       T01001                                 

Gene name
BCKDK, BCKDKD, BDK
Definition
(RefSeq) branched chain ketoacid dehydrogenase kinase
  KO
K00905  [3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase [EC:2.7.11.4]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.4  [3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase
     10295 (BCKDK)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   10295 (BCKDK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 10295
NCBI-ProteinID: NP_005872
OMIM: 614901
HGNC: 16902
Ensembl: ENSG00000103507
Vega: OTTHUMG00000047356
Pharos: O14874(Tbio)
UniProt: O14874 A0A024QZA9
Position
16p11.2
AA seq 412 aa AA seqDB search
MILASVLRSGPGGGLPLRPLLGPALALRARSTSATDTHHVEMARERSKTVTSFYNQSAID
AAAEKPSVRLTPTMMLYAGRSQDGSHLLKSARYLQQELPVRIAHRIKGFRCLPFIIGCNP
TILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLDDHKDVVTLLAEGLRESRKHI
EDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSPKKIIEKWVDFARR
LCEHKYGNAPRVRINGHVAARFPFIPMPLDYILPELLKNAMRATMESHLDTPYNVPDVVI
TIANNDVDLIIRISDRGGGIAHKDLDRVMDYHFTTAEASTQDPRISPLFGHLDMHSGAQS
GPMHGFGFGLPTSRAYAEYLGGSLQLQSLQGIGTDVYLRLRHIDGREESFRI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgatcctggcgtcggtgctgaggagcggtcccgggggcgggcttccgctccggcccctc
ctgggacccgcactcgcgctccgggcccgctcgacgtcggccaccgacacacaccacgtg
gagatggctcgggagcgctccaagaccgtcacctccttttacaaccagtcggccatcgac
gcggcagcggagaagccctcagtccgcctaacgcccaccatgatgctctacgctggccgc
tctcaggacggcagccaccttctgaaaagtgctcggtacctgcagcaagaacttccagtg
aggattgctcaccgcatcaagggcttccgctgccttcctttcatcattggctgcaacccc
accatactgcacgtgcatgagctatatatccgtgccttccagaagctgacagacttccct
ccgatcaaggaccaggcggacgaggcccagtactgccagctggtgcgacagctgctggat
gaccacaaggatgtggtgaccctcttggcagagggcctacgtgagagccggaagcacata
gaggatgaaaagctcgtccgctacttcttggacaagacgctgacttcgaggcttggaatc
cgcatgttggccacgcatcacctggcgctgcatgaggacaagcctgactttgtcggcatc
atctgtactcgtctctcaccaaagaagattattgagaagtgggtggactttgccagacgc
ctgtgtgagcacaagtatggcaatgcgccccgtgtccgcatcaatggccatgtggctgcc
cggttccccttcatccctatgccactggactacatcctgccggagctgctcaagaatgcc
atgagagccacaatggagagtcacctagacactccctacaatgtcccagatgtggtcatc
accatcgccaacaatgatgtcgatctgatcatcaggatctcagaccgtggtggaggaatc
gctcacaaagatctggaccgggtcatggactaccacttcactactgctgaggccagcaca
caggacccccggatcagccccctctttggccatctggacatgcatagtggcgcccagtca
ggacccatgcacggctttggcttcgggttgcccacgtcacgggcctacgcggagtacctc
ggtgggtctctgcagctgcagtccctgcagggcattggcacggacgtctacctgcggctc
cgccacatcgatggccgggaggaaagcttccggatctga

DBGET integrated database retrieval system