KEGG   Homo sapiens (human): 10295Help
Entry
10295             CDS       T01001                                 

Gene name
BCKDK, BCKDKD, BDK
Definition
branched chain ketoacid dehydrogenase kinase (EC:2.7.11.4)
Orthology
K00905  
[3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase [EC:2.7.11.4]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p11.2
AA seq 365 aa AA seqDB search
MILASVLRSGPGGGLPLRPLLGPALALRARSTSATDTHHVEMARERSKTVTSFYNQSAID
AAAEKPSVRLTPTMMLYAGRSQDGSHLLKSARYLQQELPVRIAHRIKGFRCLPFIIGCNP
TILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLDDHKDVVTLLAEGLRESRKHI
EDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSPKKIIEKWVDFARR
LCEHKYGNAPRVRINGHVAARFPFIPMPLDYILPELLKNAMRATMESHLDTPYNVPDVVI
TIANNDVDLIIRISDRGGGIAHKDLDRVMDYHFTTAEASTQDPRISPLFGHLDMHSGAQS
GPMHG
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgatcctggcgtcggtgctgaggagcggtcccgggggcgggcttccgctccggcccctc
ctgggacccgcactcgcgctccgggcccgctcgacgtcggccaccgacacacaccacgtg
gagatggctcgggagcgctccaagaccgtcacctccttttacaaccagtcggccatcgac
gcggcagcggagaagccctcagtccgcctaacgcccaccatgatgctctacgctggccgc
tctcaggacggcagccaccttctgaaaagtgctcggtacctgcagcaagaacttccagtg
aggattgctcaccgcatcaagggcttccgctgccttcctttcatcattggctgcaacccc
accatactgcacgtgcatgagctatatatccgtgccttccagaagctgacagacttccct
ccgatcaaggaccaggcggacgaggcccagtactgccagctggtgcgacagctgctggat
gaccacaaggatgtggtgaccctcttggcagagggcctacgtgagagccggaagcacata
gaggatgaaaagctcgtccgctacttcttggacaagacgctgacttcgaggcttggaatc
cgcatgttggccacgcatcacctggcgctgcatgaggacaagcctgactttgtcggcatc
atctgtactcgtctctcaccaaagaagattattgagaagtgggtggactttgccagacgc
ctgtgtgagcacaagtatggcaatgcgccccgtgtccgcatcaatggccatgtggctgcc
cggttccccttcatccctatgccactggactacatcctgccggagctgctcaagaatgcc
atgagagccacaatggagagtcacctagacactccctacaatgtcccagatgtggtcatc
accatcgccaacaatgatgtcgatctgatcatcaggatctcagaccgtggtggaggaatc
gctcacaaagatctggaccgggtcatggactaccacttcactactgctgaggccagcaca
caggacccccggatcagccccctctttggccatctggacatgcatagtggcgcccagtca
ggacccatgcacgggtga

DBGET integrated database retrieval system