KEGG   Homo sapiens (human): 10297Help
Entry
10297             CDS       T01001                                 

Gene name
APC2, APCL
Definition
adenomatosis polyposis coli 2
Orthology
K02085  
adenomatosis polyposis coli protein
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Regulation of actin cytoskeleton
HTLV-I infection
Pathways in cancer
MicroRNAs in cancer
Colorectal cancer
Endometrial cancer
Basal cell carcinoma
Disease
H00020  
Colorectal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    10297 (APC2)
   04390 Hippo signaling pathway
    10297 (APC2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    10297 (APC2)
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    10297 (APC2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    10297 (APC2)
   05206 MicroRNAs in cancer
    10297 (APC2)
   05210 Colorectal cancer
    10297 (APC2)
   05217 Basal cell carcinoma
    10297 (APC2)
   05213 Endometrial cancer
    10297 (APC2)
  Infectious diseases
   05166 HTLV-I infection
    10297 (APC2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     10297 (APC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 2303 aa AA seqDB search
MASSVAPYEQLVRQVEALKAENSHLRQELRDNSSHLSKLETETSGMKEVLKHLQGKLEQE
ARVLVSSGQTEVLEQLKALQMDITSLYNLKFQPPTLGPEPAARTPEGSPVHGSGPSKDSF
GELSRATIRLLEELDRERCFLLNEIEKEEKEKLWYYSQLQGLSKRLDELPHVETQFSMQM
DLIRQQLEFEAQHIRSLMEERFGTSDEMVQRAQIRASRLEQIDKELLEAQDRVQQTEPQA
LLAVKSVPVDEDPETEVPTHPEDGTPQPGNSKVEVVFWLLSMLATRDQEDTARTLLAMSS
SPESCVAMRRSGCLPLLLQILHGTEAAAGGRAGAPGAPGAKDARMRANAALHNIVFSQPD
QGLARKEMRVLHVLEQIRAYCETCWDWLQARDGGPEGGGAGSAPIPIEPQICQATCAVMK
LSFDEEYRRAMNELGGLQAVAELLQVDYEMHKMTRDPLNLALRRYAGMTLTNLTFGDVAN
KATLCARRGCMEAIVAQLASDSEELHQVVSSILRNLSWRADINSKKVLREAGSVTALVQC
VLRATKESTLKSVLSALWNLSAHSTENKAAICQVDGALGFLVSTLTYKCQSNSLAIIESG
GGILRNVSSLVATREDYRQVLRDHNCLQTLLQHLTSHSLTIVSNACGTLWNLSARSARDQ
ELLWDLGAVGMLRNLVHSKHKMIAMGSAAALRNLLAHRPAKHQAAATAVSPGSCVPSLYV
RKQRALEAELDARHLAQALEHLEKQGPPAAEAATKKPLPPLRHLDGLAQDYASDSGCFDD
DDAPSSLAAAAATGEPASPAALSLFLGSPFLQGQALARTPPTRRGGKEAEKDTSGEAAVA
AKAKAKLALAVARIDQLVEDISALHTSSDDSFSLSSGDPGQEAPREGRAQSCSPCRGPEG
GRREAGSRAHPLLRLKAAHASLSNDSLNSGSASDGYCPREHMLPCPLAALASRREDPRCG
QPRPSRLDLDLPGCQAEPPAREATSADARVRTIKLSPTYQHVPLLEGASRAGAEPLAGPG
ISPGARKQAWLPADHLSKVPEKLAAAPLSVASKALQKLAAQEGPLSLSRCSSLSSLSSAG
RPGPSEGGDLDDSDSSLEGLEEAGPSEAELDSTWRAPGATSLPVAIPAPRRNRGRGLGVE
DATPSSSSENYVQETPLVLSRCSSVSSLGSFESPSIASSIPSEPCSGQGSGTISPSELPD
SPGQTMPPSRSKTPPLAPAPQGPPEATQFSLQWESYVKRFLDIADCRERCRLPSELDAGS
VRFTVEKPDENFSCASSLSALALHEHYVQQDVELRLLPSACPERGGGAGGAGLHFAGHRR
REEGPAPTGSRPRGAADQELELLRECLGAAVPARLRKVASALVPGRRALPVPVYMLVPAP
APAQEDDSCTDSAEGTPVNFSSAASLSDETLQGPPRDQPGGPAGRQRPTGRPTSARQAMG
HRHKAGGAGRSAEQSRGAGKNRAGLELPLGRPPSAPADKDGSKPGRTRGDGALQSLCLTT
PTEEAVYCFYGNDSDEEPPAAAPTPTHRRTSAIPRAFTRERPQGRKEAPAPSKAAPAAPP
PARTQPSLIADETPPCYSLSSSASSLSEPEPSEPPAVHPRGREPAVTKDPGPGGGRDSSP
SPRAAEELLQRCISSALPRRRPPVSGLRRRKPRATRLDERPAEGSRERGEEAAGSDRASD
LDSVEWRAIQEGANSIVTWLHQAAAATREASSESDSILSFVSGLSVGSTLQPPKHRKGRQ
AEGEMGSARRPEKRGAASVKTSGSPRSPAGPEKPRGTQKTTPGVPAVLRGRTVIYVPSPA
PRAQPKGTPGPRATPRKVAPPCLAQPAAPAKVPSPGQQRSRSLHRPAKTSELATLSQPPR
SATPPARLAKTPSSSSSQTSPASQPLPRKRPPVTQAAGALPGPGASPVPKTPARTLLAKQ
HKTQRSPVRIPFMQRPARRGPPPLARAVPEPGPRGRAGTEAGPGARGGRLGLVRVASALS
SGSESSDRSGFRRQLTFIKESPGLRRRRSELSSAESAASAPQGASPRRGRPALPAVFLCS
SRCEELRAAPRQGPAPARQRPPAARPSPGERPARRTTSESPSRLPVRAPAARPETVKRYA
SLPHISVARRPDGAVPAAPASADAARRSSDGEPRPLPRVAAPGTTWRRIRDEDVPHILRS
TLPATALPLRGSTPEDAPAGPPPRKTSDAVVQTEEVAAPKTNSSTSPSLETREPPGAPAG
GQLSLLGSDVDGPSLAKAPISAPFVHEGLGVAVGGFPASRHGSPSRSARVPPFNYVPSPM
VVAATTDSAAEKAPATASATLLE
NT seq 6912 nt NT seq  +upstreamnt  +downstreamnt
atggcgagctccgtggcgccctacgagcagctggtgaggcaggtggaggccttgaaggct
gagaacagccacctgaggcaggagctaagggacaactccagccacctgtccaagctggag
acagagacgtcgggcatgaaggaggtcctgaagcacctacagggaaaactggagcaggag
gcccgagtgctggtgtcctcggggcagacggaggtgctggagcagctgaaggccctacag
atggacatcaccagcctgtacaacctcaagttccagccgcccaccctgggcccggagcct
gccgcccggacccccgagggcagcccagtacacggctccgggccctccaaggacagcttt
ggggagctgagccgggccaccatccggctgctggaggaactggaccgggaacggtgtttc
ctgctgaatgagattgagaaggaggagaaggagaagctctggtactactctcagctgcag
ggcctgtccaagcgcctggacgagctgccgcacgtggagacgcagttctcgatgcagatg
gacctgatccggcagcagcttgagttcgaggcccagcacatccgctcgctgatggaggag
cgcttcggcacctcggacgagatggtgcagcgggcacagatccgcgcctcgcgcctggag
cagattgacaaggagctgctggaggcgcaggaccgagtgcagcagacggagccccaggcc
ttgctggcggtgaagtcggtgccggtggacgaggaccccgagacagaggtccccacacac
cctgaggatggcacccctcagccgggcaacagcaaggtggaggtggtcttctggctgttg
tccatgttggcgacgcgcgaccaggaggatacagcgcgcacgctgctggccatgtccagc
tcgcccgagagctgcgtggccatgcgccgctcgggctgtctgcctctgctgctgcaaatc
ctccacggcaccgaggccgcggccgggggtcgcgccggggccccaggggcaccgggcgcc
aaggacgcacgcatgcgcgccaacgcggcgctgcacaacatcgtcttctcgcagccggac
cagggcctggcgcgcaaggagatgcgcgtcctgcacgtgctggagcagatccgggcctac
tgcgagacctgctgggactggctgcaggcccgagacggcgggcccgagggaggtggcgcc
ggcagcgccccgatccccatcgagccgcagatctgccaggccacctgtgctgttatgaag
ctgtcctttgatgaggagtaccgccgtgccatgaacgagctaggtgggctgcaggccgtg
gcagagctgctgcaggttgactatgagatgcacaagatgacccgggacccgctgaacctg
gcgctgcgccgctacgcgggcatgaccctcaccaacctcacctttggggacgttgccaac
aaggccaccctgtgtgcgcgccgcggctgcatggaggccatcgtggcccagctggcctcc
gacagtgaggagctccaccaggtggtgtccagcatccttcggaacttgtcctggagggcc
gacatcaacagcaagaaggtgctgagggaggcgggcagcgtgactgccctggtgcagtgt
gtcctgcgggccaccaaggagtccaccctgaagagcgtgctgagcgccctgtggaatctg
tctgcacacagcacagagaacaaggcggccatctgccaggtggatggcgccctgggcttc
ctggtgagcaccctgacctacaagtgtcagagcaactcgctggccatcatcgagagcggc
ggcggcatcctccgcaatgtgtccagcctcgtcgccacccgtgaggactacaggcaggtg
ctccgggatcacaactgtctgcagacgctgctgcagcatctgacttcgcacagcctgacc
atcgtgagcaacgcgtgcggcacgctctggaacctgtcggcccgcagcgcccgtgaccag
gagctgctgtgggacctgggcgccgtgggcatgctgcgtaatctggtgcactccaagcac
aagatgatcgccatgggcagcgccgccgccctgcgcaacctgctggcccatcggcccgcc
aagcaccaggcggccgccaccgccgtgtccccaggcagctgcgtgcccagcctgtacgtg
cgcaagcagcgggcgctggaggccgagctggacgcacggcacctcgcgcaggcgctggag
cacctggagaagcagggcccgccggcagccgaggccgccactaagaagccgctgccgccc
ctgcgacacctggacggcctggcccaagactatgcttccgattcgggctgctttgacgac
gacgatgcaccgtcatccctggctgcggccgcggccaccggggagccagccagccctgcc
gcgctgtccctcttcctgggcagccccttcctgcaggggcaggcgctggctcgcaccccg
cccacccgccgaggcggcaaggaggcagagaaggacaccagtggggaggcagccgtggcg
gccaaggccaaggccaagctggcgcttgcagtggcgcgcatcgaccagctggtggaggac
atctccgccctgcacacctcgtccgacgatagcttcagcctcagctctggagacccggga
caggaggcgccacgggagggccgcgcccagtcctgctcgccatgccgcggcccggagggc
gggcggcgagaggcaggaagccgggcgcacccgctgctgcggctcaaggcggcccacgcc
agcctctccaacgacagcctcaacagcggcagtgccagcgacgggtactgcccacgcgaa
catatgctgccctgcccgctggccgcactggcttcgcgccgcgaggaccccaggtgtggg
cagcctcggcccagccggcttgaccttgacctgcccggctgccaggccgagcccccggcc
cgcgaggccacctccgccgacgcccgcgtgcgcaccatcaagctgtcgcctacctatcag
cacgtgccactgcttgagggtgcctcaagggcgggtgcagagcccctcgcggggcctgga
atctctccaggggcccggaagcaggcctggctgccggcagaccacctgagcaaggttccc
gagaagctggcggctgccccgctgtctgtggccagcaaggcactgcagaaactggcggcg
caagaggggccactctcgctgtcccgatgcagctccctttcctcgctgtcctcggccggc
cgcccaggccccagcgagggtggtgacctggatgacagtgactcctccctggaggggctg
gaggaggccggccccagcgaggctgagctggacagcacgtggcgggcgcccggggccacc
tcgctgcccgtagccattccggctccccggcgtaaccgaggccggggcctgggggtggaa
gacgccacgccgtccagctcgtcggagaactacgtgcaggagacaccgcttgtgctgagc
cgctgcagctctgtgagctcgctgggcagcttcgagagcccgtccatcgccagctccatc
cccagtgaaccttgcagcgggcagggcagcggcaccatcagccctagcgagctgcccgac
agccccggacagaccatgcctcccagccggagcaagacgccaccgctggcgcccgcgcca
cagggtccccccgaggccacccagttcagcctgcagtgggagagctacgtgaagcgcttc
ctggacatcgccgactgccgggagcgctgccggctgccatctgagctggacgcaggcagc
gtgcgctttaccgtggagaagccagacgagaacttctcgtgcgcctccagcctcagcgcg
ctggccttgcacgagcactacgtgcagcaggacgtggagctgcggctgctgccctcggcc
tgccccgagcgcggcgggggcgccgggggcgccggcctccactttgcagggcaccggcgg
cgggaggaggggccggcgcccacgggttctcgccctcgcggcgccgcggaccaggagctg
gaactgctgcgggagtgcctgggagccgccgtgcctgcccggctgcgcaaggtggcctcc
gcgctggtgccaggtcgccgcgcactccccgtgcccgtctacatgttggtgcccgccccg
gccccggcccaggaggacgactcctgcactgactccgcggagggcacgccggtcaacttc
tctagcgccgcctcgctcagcgacgagacgctgcagggaccccccagggaccagcccggg
ggaccagcgggcaggcaaagacccaccggccgccccacctctgccagacaggccatgggg
caccggcacaaggcgggaggcgccggccgcagcgcggagcagtctcggggcgcgggcaag
aacagagcagggctggagctgcccctgggccggcccccgagcgcccccgcagacaaggac
ggctcaaagcccggccggacccgcggggacggggcgctccagtcgctgtgcctcacgacg
cccactgaggaggccgtgtactgcttctacggcaacgactcggacgaggagcccccggcg
gccgcgcccacgccaacccaccggcgcacatcggccatccctcgcgcttttacgcgggag
cgtccgcagggccggaaggaggcccctgccccgtccaaggctgcaccagctgccccgccg
cccgcccggacccagcccagcctcattgctgacgagaccccgccctgctactccctgagc
tcctccgccagctccctcagcgagcccgagccctcggagccgccggccgtccatccacga
ggccgggagcccgcggtcaccaaggacccgggcccaggaggcggacgcgacagctcgccc
agcccgcgggccgcggaggagcttctgcagcggtgcatcagctcggccctgcccaggcgc
cggccccccgtgtctggcctgcggcgccgcaagccccgagccacccggctggatgagcgg
cccgcagaggggtcccgggaacgcggcgaggaggcagcgggctcggaccgggcctccgac
ctggatagcgtggagtggcgcgccatccaggagggcgccaattcaattgtcacgtggctg
caccaggcagcagctgccacgcgggaggcctcgtccgagtccgactccatcctgtccttc
gtatccgggctgtcagtgggatccaccctacagccccccaagcacaggaagggacgacag
gcggagggagaaatgggcagtgcccggcggccagagaaaaggggcgcagcctcagtcaag
accagcgggagcccccgttcccctgcaggccccgagaagccacgtggcacacagaagacc
acgcccggggtgccagctgtgctccggggacgaacagtgatctacgtccccagcccggca
ccccgtgcccagcccaaagggacccccggcccccgcgccacaccgcggaaggtggcgccc
ccttgcctggcacagcccgcggctccagccaaagtcccgagccccgggcagcagcggtcg
cggagcctacaccggcctgccaagacctcggagctggcgacgctgagccagccccccaga
agcgccacaccgcccgcccgcctcgccaagaccccctcctccagctcctcccagacctcg
cccgcctcccagcccctgcccagaaagcgccccccggtcacccaggctgctggggccctg
cccggccccggagcctccccggtgcccaaaacgccggcgcgcacccttctggcgaagcag
cacaagacgcagagatcgcccgtgcggatcccgttcatgcagaggccggcccggcgtggg
ccgccaccgctggctcgggcagtcccggagccgggccccaggggccgggcggggaccgag
gcgggcccgggggcgcgcgggggccgcctgggcctggtgcgtgtggcctcagccctctcc
agcggcagcgagtcctccgaccgctcgggcttccggcgacagctaaccttcatcaaggag
tcgccgggcttgcggcgccgccgctccgagctgtcctcggccgagtccgcggcctctgcc
ccccagggcgcctcgccccgccgcggccggcccgcgctgcccgccgtcttcctctgctcc
tcgcgctgcgaagagctccgagcggcaccccggcagggcccggccccggcccggcagcgg
ccccccgcggcccgacccagccctggcgagcgccctgcccggcgcaccacctccgagagc
ccgtcccgcctgcctgtgcgcgcgcccgccgcccggccggagactgtcaagcgctacgcg
tcgctgccgcacatcagcgtggcccgcaggcccgacggcgccgtccccgcggcccctgcc
tcagccgacgccgcgcgccgcagcagcgacggggagccccggccgctccccagggtggcc
gcgccgggcacgacctggcggcgcatccgagatgaggacgtgccccacatcctgcgcagc
acgcttcccgccacggccctgccactgcggggctccacgcccgaggacgccccggccggg
cccccgccgcgcaagaccagcgacgccgtggtccagaccgaggaggtcgccgcccccaag
accaactccagcacgtccccgagcctggagaccagggagccccccggggcccccgccggc
ggccagctctccctcctcggcagcgacgtggacggtcccagcctcgccaaggctcccatc
tccgcacccttcgtgcacgagggcctgggggtcgccgtggggggcttccccgccagccgg
cacggctcccccagccgctcggcccgagtaccccccttcaactatgtgcccagccccatg
gtggtcgcagccaccaccgactcggccgcggagaaagccccggccactgcctccgccacc
ctcctggaatag

DBGET integrated database retrieval system