KEGG   Homo sapiens (human): 10297Help
Entry
10297             CDS       T01001                                 

Gene name
APC2, APCL
Definition
adenomatosis polyposis coli 2
Orthology
K02085  
adenomatosis polyposis coli protein
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Hippo signaling pathway
Regulation of actin cytoskeleton
HTLV-I infection
Pathways in cancer
MicroRNAs in cancer
Colorectal cancer
Endometrial cancer
Basal cell carcinoma
Disease
H00020  
Colorectal cancer
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:hsa04310]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
Human Diseases; Cancers; Colorectal cancer [PATH:hsa05210]
Human Diseases; Cancers; Basal cell carcinoma [PATH:hsa05217]
Human Diseases; Cancers; Endometrial cancer [PATH:hsa05213]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 2303 aa AA seqDB search
MASSVAPYEQLVRQVEALKAENSHLRQELRDNSSHLSKLETETSGMKEVLKHLQGKLEQE
ARVLVSSGQTEVLEQLKALQMDITSLYNLKFQPPTLGPEPAARTPEGSPVHGSGPSKDSF
GELSRATIRLLEELDRERCFLLNEIEKEEKEKLWYYSQLQGLSKRLDELPHVETQFSMQM
DLIRQQLEFEAQHIRSLMEERFGTSDEMVQRAQIRASRLEQIDKELLEAQDRVQQTEPQA
LLAVKSVPVDEDPETEVPTHPEDGTPQPGNSKVEVVFWLLSMLATRDQEDTARTLLAMSS
SPESCVAMRRSGCLPLLLQILHGTEAAAGGRAGAPGAPGAKDARMRANAALHNIVFSQPD
QGLARKEMRVLHVLEQIRAYCETCWDWLQARDGGPEGGGAGSAPIPIEPQICQATCAVMK
LSFDEEYRRAMNELGGLQAVAELLQVDYEMHKMTRDPLNLALRRYAGMTLTNLTFGDVAN
KATLCARRGCMEAIVAQLASDSEELHQVVSSILRNLSWRADINSKKVLREAGSVTALVQC
VLRATKESTLKSVLSALWNLSAHSTENKAAICQVDGALGFLVSTLTYKCQSNSLAIIESG
GGILRNVSSLVATREDYRQVLRDHNCLQTLLQHLTSHSLTIVSNACGTLWNLSARSARDQ
ELLWDLGAVGMLRNLVHSKHKMIAMGSAAALRNLLAHRPAKHQAAATAVSPGSCVPSLYV
RKQRALEAELDARHLAQALEHLEKQGPPAAEAATKKPLPPLRHLDGLAQDYASDSGCFDD
DDAPSSLAAAAATGEPASPAALSLFLGSPFLQGQALARTPPTRRGGKEAEKDTSGEAAVA
AKAKAKLALAVARIDQLVEDISALHTSSDDSFSLSSGDPGQEAPREGRAQSCSPCRGPEG
GRREAGSRAHPLLRLKAAHASLSNDSLNSGSASDGYCPREHMLPCPLAALASRREDPRCG
QPRPSRLDLDLPGCQAEPPAREATSADARVRTIKLSPTYQHVPLLEGASRAGAEPLAGPG
ISPGARKQAWLPADHLSKVPEKLAAAPLSVASKALQKLAAQEGPLSLSRCSSLSSLSSAG
RPGPSEGGDLDDSDSSLEGLEEAGPSEAELDSTWRAPGATSLPVAIPAPRRNRGRGLGVE
DATPSSSSENYVQETPLVLSRCSSVSSLGSFESPSIASSIPSEPCSGQGSGTISPSELPD
SPGQTMPPSRSKTPPLAPAPQGPPEATQFSLQWESYVKRFLDIADCRERCRLPSELDAGS
VRFTVEKPDENFSCASSLSALALHEHYVQQDVELRLLPSACPERGGGAGGAGLHFAGHRR
REEGPAPTGSRPRGAADQELELLRECLGAAVPARLRKVASALVPGRRALPVPVYMLVPAP
APAQEDDSCTDSAEGTPVNFSSAASLSDETLQGPPRDQPGGPAGRQRPTGRPTSARQAMG
HRHKAGGAGRSAEQSRGAGKNRAGLELPLGRPPSAPADKDGSKPGRTRGDGALQSLCLTT
PTEEAVYCFYGNDSDEEPPAAAPTPTHRRTSAIPRAFTRERPQGRKEAPAPSKAAPAAPP
PARTQPSLIADETPPCYSLSSSASSLSEPEPSEPPAVHPRGREPAVTKDPGPGGGRDSSP
SPRAAEELLQRCISSALPRRRPPVSGLRRRKPRATRLDERPAEGSRERGEEAAGSDRASD
LDSVEWRAIQEGANSIVTWLHQAAAATREASSESDSILSFVSGLSVGSTLQPPKHRKGRQ
AEGEMGSARRPEKRGAASVKTSGSPRSPAGPEKPRGTQKTTPGVPAVLRGRTVIYVPSPA
PRAQPKGTPGPRATPRKVAPPCLAQPAAPAKVPSPGQQRSRSLHRPAKTSELATLSQPPR
SATPPARLAKTPSSSSSQTSPASQPLPRKRPPVTQAAGALPGPGASPVPKTPARTLLAKQ
HKTQRSPVRIPFMQRPARRGPPPLARAVPEPGPRGRAGTEAGPGARGGRLGLVRVASALS
SGSESSDRSGFRRQLTFIKESPGLRRRRSELSSAESAASAPQGASPRRGRPALPAVFLCS
SRCEELRAAPRQGPAPARQRPPAARPSPGERPARRTTSESPSRLPVRAPAARPETVKRYA
SLPHISVARRPDGAVPAAPASADAARRSSDGEPRPLPRVAAPGTTWRRIRDEDVPHILRS
TLPATALPLRGSTPEDAPAGPPPRKTSDAVVQTEEVAAPKTNSSTSPSLETREPPGAPAG
GQLSLLGSDVDGPSLAKAPISAPFVHEGLGVAVGGFPASRHGSPSRSARVPPFNYVPSPM
VVAATTDSAAEKAPATASATLLE
NT seq 6912 nt NT seq  +upstreamnt  +downstreamnt
atggcgagctccgtggcgccctacgagcagctggtgaggcaggtggaggccttgaaggct
gagaacagccacctgaggcaggagctaagggacaactccagccacctgtccaagctggag
acagagacgtcgggcatgaaggaggtcctgaagcacctacagggaaaactggagcaggag
gcccgagtgctggtgtcctcggggcagacggaggtgctggagcagctgaaggccctacag
atggacatcaccagcctgtacaacctcaagttccagccgcccaccctgggcccggagcct
gccgcccggacccccgagggcagcccagtacacggctccgggccctccaaggacagcttt
ggggagctgagccgggccaccatccggctgctggaggaactggaccgggaacggtgtttc
ctgctgaatgagattgagaaggaggagaaggagaagctctggtactactctcagctgcag
ggcctgtccaagcgcctggacgagctgccgcacgtggagacgcagttctcgatgcagatg
gacctgatccggcagcagcttgagttcgaggcccagcacatccgctcgctgatggaggag
cgcttcggcacctcggacgagatggtgcagcgggcacagatccgcgcctcgcgcctggag
cagattgacaaggagctgctggaggcgcaggaccgagtgcagcagacggagccccaggcc
ttgctggcggtgaagtcggtgccggtggacgaggaccccgagacagaggtccccacacac
cctgaggatggcacccctcagccgggcaacagcaaggtggaggtggtcttctggctgttg
tccatgttggcgacgcgcgaccaggaggatacagcgcgcacgctgctggccatgtccagc
tcgcccgagagctgcgtggccatgcgccgctcgggctgtctgcctctgctgctgcaaatc
ctccacggcaccgaggccgcggccgggggtcgcgccggggccccaggggcaccgggcgcc
aaggacgcacgcatgcgcgccaacgcggcgctgcacaacatcgtcttctcgcagccggac
cagggcctggcgcgcaaggagatgcgcgtcctgcacgtgctggagcagatccgggcctac
tgcgagacctgctgggactggctgcaggcccgagacggcgggcccgagggaggtggcgcc
ggcagcgccccgatccccatcgagccgcagatctgccaggccacctgtgctgttatgaag
ctgtcctttgatgaggagtaccgccgtgccatgaacgagctaggtgggctgcaggccgtg
gcagagctgctgcaggttgactatgagatgcacaagatgacccgggacccgctgaacctg
gcgctgcgccgctacgcgggcatgaccctcaccaacctcacctttggggacgttgccaac
aaggccaccctgtgtgcgcgccgcggctgcatggaggccatcgtggcccagctggcctcc
gacagtgaggagctccaccaggtggtgtccagcatccttcggaacttgtcctggagggcc
gacatcaacagcaagaaggtgctgagggaggcgggcagcgtgactgccctggtgcagtgt
gtcctgcgggccaccaaggagtccaccctgaagagcgtgctgagcgccctgtggaatctg
tctgcacacagcacagagaacaaggcggccatctgccaggtggatggcgccctgggcttc
ctggtgagcaccctgacctacaagtgtcagagcaactcgctggccatcatcgagagcggc
ggcggcatcctccgcaatgtgtccagcctcgtcgccacccgtgaggactacaggcaggtg
ctccgggatcacaactgtctgcagacgctgctgcagcatctgacttcgcacagcctgacc
atcgtgagcaacgcgtgcggcacgctctggaacctgtcggcccgcagcgcccgtgaccag
gagctgctgtgggacctgggcgccgtgggcatgctgcgtaatctggtgcactccaagcac
aagatgatcgccatgggcagcgccgccgccctgcgcaacctgctggcccatcggcccgcc
aagcaccaggcggccgccaccgccgtgtccccaggcagctgcgtgcccagcctgtacgtg
cgcaagcagcgggcgctggaggccgagctggacgcacggcacctcgcgcaggcgctggag
cacctggagaagcagggcccgccggcagccgaggccgccactaagaagccgctgccgccc
ctgcgacacctggacggcctggcccaagactatgcttccgattcgggctgctttgacgac
gacgatgcaccgtcatccctggctgcggccgcggccaccggggagccagccagccctgcc
gcgctgtccctcttcctgggcagccccttcctgcaggggcaggcgctggctcgcaccccg
cccacccgccgaggcggcaaggaggcagagaaggacaccagtggggaggcagccgtggcg
gccaaggccaaggccaagctggcgcttgcagtggcgcgcatcgaccagctggtggaggac
atctccgccctgcacacctcgtccgacgatagcttcagcctcagctctggagacccggga
caggaggcgccacgggagggccgcgcccagtcctgctcgccatgccgcggcccggagggc
gggcggcgagaggcaggaagccgggcgcacccgctgctgcggctcaaggcggcccacgcc
agcctctccaacgacagcctcaacagcggcagtgccagcgacgggtactgcccacgcgaa
catatgctgccctgcccgctggccgcactggcttcgcgccgcgaggaccccaggtgtggg
cagcctcggcccagccggcttgaccttgacctgcccggctgccaggccgagcccccggcc
cgcgaggccacctccgccgacgcccgcgtgcgcaccatcaagctgtcgcctacctatcag
cacgtgccactgcttgagggtgcctcaagggcgggtgcagagcccctcgcggggcctgga
atctctccaggggcccggaagcaggcctggctgccggcagaccacctgagcaaggttccc
gagaagctggcggctgccccgctgtctgtggccagcaaggcactgcagaaactggcggcg
caagaggggccactctcgctgtcccgatgcagctccctttcctcgctgtcctcggccggc
cgcccaggccccagcgagggtggtgacctggatgacagtgactcctccctggaggggctg
gaggaggccggccccagcgaggctgagctggacagcacgtggcgggcgcccggggccacc
tcgctgcccgtagccattccggctccccggcgtaaccgaggccggggcctgggggtggaa
gacgccacgccgtccagctcgtcggagaactacgtgcaggagacaccgcttgtgctgagc
cgctgcagctctgtgagctcgctgggcagcttcgagagcccgtccatcgccagctccatc
cccagtgaaccttgcagcgggcagggcagcggcaccatcagccctagcgagctgcccgac
agccccggacagaccatgcctcccagccggagcaagacgccaccgctggcgcccgcgcca
cagggtccccccgaggccacccagttcagcctgcagtgggagagctacgtgaagcgcttc
ctggacatcgccgactgccgggagcgctgccggctgccatctgagctggacgcaggcagc
gtgcgctttaccgtggagaagccagacgagaacttctcgtgcgcctccagcctcagcgcg
ctggccttgcacgagcactacgtgcagcaggacgtggagctgcggctgctgccctcggcc
tgccccgagcgcggcgggggcgccgggggcgccggcctccactttgcagggcaccggcgg
cgggaggaggggccggcgcccacgggttctcgccctcgcggcgccgcggaccaggagctg
gaactgctgcgggagtgcctgggagccgccgtgcctgcccggctgcgcaaggtggcctcc
gcgctggtgccaggtcgccgcgcactccccgtgcccgtctacatgttggtgcccgccccg
gccccggcccaggaggacgactcctgcactgactccgcggagggcacgccggtcaacttc
tctagcgccgcctcgctcagcgacgagacgctgcagggaccccccagggaccagcccggg
ggaccagcgggcaggcaaagacccaccggccgccccacctctgccagacaggccatgggg
caccggcacaaggcgggaggcgccggccgcagcgcggagcagtctcggggcgcgggcaag
aacagagcagggctggagctgcccctgggccggcccccgagcgcccccgcagacaaggac
ggctcaaagcccggccggacccgcggggacggggcgctccagtcgctgtgcctcacgacg
cccactgaggaggccgtgtactgcttctacggcaacgactcggacgaggagcccccggcg
gccgcgcccacgccaacccaccggcgcacatcggccatccctcgcgcttttacgcgggag
cgtccgcagggccggaaggaggcccctgccccgtccaaggctgcaccagctgccccgccg
cccgcccggacccagcccagcctcattgctgacgagaccccgccctgctactccctgagc
tcctccgccagctccctcagcgagcccgagccctcggagccgccggccgtccatccacga
ggccgggagcccgcggtcaccaaggacccgggcccaggaggcggacgcgacagctcgccc
agcccgcgggccgcggaggagcttctgcagcggtgcatcagctcggccctgcccaggcgc
cggccccccgtgtctggcctgcggcgccgcaagccccgagccacccggctggatgagcgg
cccgcagaggggtcccgggaacgcggcgaggaggcagcgggctcggaccgggcctccgac
ctggatagcgtggagtggcgcgccatccaggagggcgccaattcaattgtcacgtggctg
caccaggcagcagctgccacgcgggaggcctcgtccgagtccgactccatcctgtccttc
gtatccgggctgtcagtgggatccaccctacagccccccaagcacaggaagggacgacag
gcggagggagaaatgggcagtgcccggcggccagagaaaaggggcgcagcctcagtcaag
accagcgggagcccccgttcccctgcaggccccgagaagccacgtggcacacagaagacc
acgcccggggtgccagctgtgctccggggacgaacagtgatctacgtccccagcccggca
ccccgtgcccagcccaaagggacccccggcccccgcgccacaccgcggaaggtggcgccc
ccttgcctggcacagcccgcggctccagccaaagtcccgagccccgggcagcagcggtcg
cggagcctacaccggcctgccaagacctcggagctggcgacgctgagccagccccccaga
agcgccacaccgcccgcccgcctcgccaagaccccctcctccagctcctcccagacctcg
cccgcctcccagcccctgcccagaaagcgccccccggtcacccaggctgctggggccctg
cccggccccggagcctccccggtgcccaaaacgccggcgcgcacccttctggcgaagcag
cacaagacgcagagatcgcccgtgcggatcccgttcatgcagaggccggcccggcgtggg
ccgccaccgctggctcgggcagtcccggagccgggccccaggggccgggcggggaccgag
gcgggcccgggggcgcgcgggggccgcctgggcctggtgcgtgtggcctcagccctctcc
agcggcagcgagtcctccgaccgctcgggcttccggcgacagctaaccttcatcaaggag
tcgccgggcttgcggcgccgccgctccgagctgtcctcggccgagtccgcggcctctgcc
ccccagggcgcctcgccccgccgcggccggcccgcgctgcccgccgtcttcctctgctcc
tcgcgctgcgaagagctccgagcggcaccccggcagggcccggccccggcccggcagcgg
ccccccgcggcccgacccagccctggcgagcgccctgcccggcgcaccacctccgagagc
ccgtcccgcctgcctgtgcgcgcgcccgccgcccggccggagactgtcaagcgctacgcg
tcgctgccgcacatcagcgtggcccgcaggcccgacggcgccgtccccgcggcccctgcc
tcagccgacgccgcgcgccgcagcagcgacggggagccccggccgctccccagggtggcc
gcgccgggcacgacctggcggcgcatccgagatgaggacgtgccccacatcctgcgcagc
acgcttcccgccacggccctgccactgcggggctccacgcccgaggacgccccggccggg
cccccgccgcgcaagaccagcgacgccgtggtccagaccgaggaggtcgccgcccccaag
accaactccagcacgtccccgagcctggagaccagggagccccccggggcccccgccggc
ggccagctctccctcctcggcagcgacgtggacggtcccagcctcgccaaggctcccatc
tccgcacccttcgtgcacgagggcctgggggtcgccgtggggggcttccccgccagccgg
cacggctcccccagccgctcggcccgagtaccccccttcaactatgtgcccagccccatg
gtggtcgcagccaccaccgactcggccgcggagaaagccccggccactgcctccgccacc
ctcctggaatag

DBGET integrated database retrieval system