KEGG   Homo sapiens (human): 10298Help
Entry
10298             CDS       T01001                                 

Gene name
PAK4
Definition
(RefSeq) p21 (RAC1) activated kinase 4 (EC:2.7.11.1)
  KO
K05734  
p21-activated kinase 4 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
MicroRNAs in cancer
Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    10298 (PAK4)
   04012 ErbB signaling pathway
    10298 (PAK4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    10298 (PAK4)
  Cellular community - eukaryotes
   04510 Focal adhesion
    10298 (PAK4)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    10298 (PAK4)
  Development
   04360 Axon guidance
    10298 (PAK4)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    10298 (PAK4)
   05211 Renal cell carcinoma
    10298 (PAK4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     10298 (PAK4)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   10298 (PAK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.2
AA seq 591 aa AA seqDB search
MFGKRKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLVDPACIT
SIQPGAPKTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGMPEE
PATTARGGPGKAGSRGRFAGHSEAGGGSGDRRRAGPEKRPKSSREGSGGPQESSRDKRPL
SGPDVGTPQPAGLASGAKLAAGRPFNTYPRADTDHPSRGAQGEPHDVAPNGPSAGGLAIP
QSSSSSSRPPTRARGAPSPGVLGPHASEPQLAPPACTPAAPAVPGPPGPRSPQREPQRVS
HEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRR
ELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAV
CLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPY
WMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHK
VSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggaagaggaagaagcgggtggagatctccgcgccgtccaacttcgagcaccgc
gtgcacacgggcttcgaccagcacgagcagaagttcacggggctgccccgccagtggcag
agcctgatcgaggagtcggctcgccggcccaagcccctcgtcgaccccgcctgcatcacc
tccatccagcccggggcccccaagaccatcgtgcggggcagcaaaggtgccaaagatggg
gccctcacgctgctgctggacgagtttgagaacatgtcggtgacacgctccaactccctg
cggagagacagcccgccgccgcccgcccgtgcccgccaggaaaatgggatgccagaggag
ccggccaccacggccagagggggcccagggaaggcaggcagccgaggccggttcgccggt
cacagcgaggcgggtggcggcagtggtgacaggcgacgggcggggccagagaagaggccc
aagtcttccagggagggctcagggggtccccaggagtcctcccgggacaaacgccccctc
tccgggcctgatgtcggcaccccccagcctgctggtctggccagtggggcgaaactggca
gctggccggccctttaacacctacccgagggctgacacggaccacccatcccggggtgcc
cagggggagcctcatgacgtggcccctaacgggccatcagcggggggcctggccatcccc
cagtcctcctcctcctcctcccggcctcccacccgagcccgaggtgcccccagccctgga
gtgctgggaccccacgcctcagagccccagctggcccctccagcctgcacccccgccgcc
cctgctgttcctgggccccctggcccccgctcaccacagcgggagccacagcgagtatcc
catgagcagttccgggctgccctgcagctggtggtggacccaggcgacccccgctcctac
ctggacaacttcatcaagattggcgagggctccacgggcatcgtgtgcatcgccaccgtg
cgcagctcgggcaagctggtggccgtcaagaagatggacctgcgcaagcagcagaggcgc
gagctgctcttcaacgaggtggtaatcatgagggactaccagcacgagaatgtggtggag
atgtacaacagctacctggtgggggacgagctctgggtggtcatggagttcctggaagga
ggcgccctcaccgacatcgtcacccacaccaggatgaacgaggagcagatcgcggccgtg
tgccttgcagtgctgcaggccctgtcggtgctccacgcccagggcgtcatccaccgggac
atcaagagcgactcgatcctgctgacccatgatggcagggtgaagctgtcagactttggg
ttctgcgcccaggtgagcaaggaagtgccccgaaggaagtcgctggtcggcacgccctac
tggatggccccagagctcatctcccgccttccctacgggccagaggtagacatctggtcg
ctggggataatggtgattgagatggtggacggagagcccccctacttcaacgagccaccc
ctcaaagccatgaagatgattcgggacaacctgccaccccgactgaagaacctgcacaag
gtgtcgccatccctgaagggcttcctggaccgcctgctggtgcgagaccctgcccagcgg
gccacggcagccgagctgctgaagcacccattcctggccaaggcagggccgcctgccagc
atcgtgcccctcatgcgccagaaccgcaccagatga

DBGET integrated database retrieval system