KEGG   Homo sapiens (human): 10298Help
Entry
10298             CDS       T01001                                 

Gene name
PAK4
Definition
p21 protein (Cdc42/Rac)-activated kinase 4 (EC:2.7.11.1)
Orthology
K05734  
p21-activated kinase 4 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
MicroRNAs in cancer
Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    10298 (PAK4)
   04012 ErbB signaling pathway
    10298 (PAK4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    10298 (PAK4)
  Cellular commiunity
   04510 Focal adhesion
    10298 (PAK4)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    10298 (PAK4)
  Development
   04360 Axon guidance
    10298 (PAK4)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    10298 (PAK4)
   05211 Renal cell carcinoma
    10298 (PAK4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     10298 (PAK4)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   10298 (PAK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.2
AA seq 591 aa AA seqDB search
MFGKRKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLVDPACIT
SIQPGAPKTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGMPEE
PATTARGGPGKAGSRGRFAGHSEAGGGSGDRRRAGPEKRPKSSREGSGGPQESSRDKRPL
SGPDVGTPQPAGLASGAKLAAGRPFNTYPRADTDHPSRGAQGEPHDVAPNGPSAGGLAIP
QSSSSSSRPPTRARGAPSPGVLGPHASEPQLAPPACTPAAPAVPGPPGPRSPQREPQRVS
HEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRR
ELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAV
CLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPY
WMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHK
VSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggaagaggaagaagcgggtggagatctccgcgccgtccaacttcgagcaccgc
gtgcacacgggcttcgaccagcacgagcagaagttcacggggctgccccgccagtggcag
agcctgatcgaggagtcggctcgccggcccaagcccctcgtcgaccccgcctgcatcacc
tccatccagcccggggcccccaagaccatcgtgcggggcagcaaaggtgccaaagatggg
gccctcacgctgctgctggacgagtttgagaacatgtcggtgacacgctccaactccctg
cggagagacagcccgccgccgcccgcccgtgcccgccaggaaaatgggatgccagaggag
ccggccaccacggccagagggggcccagggaaggcaggcagccgaggccggttcgccggt
cacagcgaggcgggtggcggcagtggtgacaggcgacgggcggggccagagaagaggccc
aagtcttccagggagggctcagggggtccccaggagtcctcccgggacaaacgccccctc
tccgggcctgatgtcggcaccccccagcctgctggtctggccagtggggcgaaactggca
gctggccggccctttaacacctacccgagggctgacacggaccacccatcccggggtgcc
cagggggagcctcatgacgtggcccctaacgggccatcagcggggggcctggccatcccc
cagtcctcctcctcctcctcccggcctcccacccgagcccgaggtgcccccagccctgga
gtgctgggaccccacgcctcagagccccagctggcccctccagcctgcacccccgccgcc
cctgctgttcctgggccccctggcccccgctcaccacagcgggagccacagcgagtatcc
catgagcagttccgggctgccctgcagctggtggtggacccaggcgacccccgctcctac
ctggacaacttcatcaagattggcgagggctccacgggcatcgtgtgcatcgccaccgtg
cgcagctcgggcaagctggtggccgtcaagaagatggacctgcgcaagcagcagaggcgc
gagctgctcttcaacgaggtggtaatcatgagggactaccagcacgagaatgtggtggag
atgtacaacagctacctggtgggggacgagctctgggtggtcatggagttcctggaagga
ggcgccctcaccgacatcgtcacccacaccaggatgaacgaggagcagatcgcggccgtg
tgccttgcagtgctgcaggccctgtcggtgctccacgcccagggcgtcatccaccgggac
atcaagagcgactcgatcctgctgacccatgatggcagggtgaagctgtcagactttggg
ttctgcgcccaggtgagcaaggaagtgccccgaaggaagtcgctggtcggcacgccctac
tggatggccccagagctcatctcccgccttccctacgggccagaggtagacatctggtcg
ctggggataatggtgattgagatggtggacggagagcccccctacttcaacgagccaccc
ctcaaagccatgaagatgattcgggacaacctgccaccccgactgaagaacctgcacaag
gtgtcgccatccctgaagggcttcctggaccgcctgctggtgcgagaccctgcccagcgg
gccacggcagccgagctgctgaagcacccattcctggccaaggcagggccgcctgccagc
atcgtgcccctcatgcgccagaaccgcaccagatga

DBGET integrated database retrieval system