KEGG   Homo sapiens (human): 103Help
Entry
103               CDS       T01001                                 

Gene name
ADAR, ADAR1, AGS6, DRADA, DSH, DSRAD, G1P1, IFI-4, IFI4, K88DSRBP, P136
Definition
(RefSeq) adenosine deaminase, RNA specific (EC:3.5.4.37)
  KO
K12968  
double-stranded RNA-specific adenosine deaminase [EC:3.5.4.37]
Organism
hsa  Homo sapiens (human)
Pathway
Cytosolic DNA-sensing pathway
Measles
Influenza A
Disease
H00880  
Dyschromatosis symmetrica hereditaria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04623 Cytosolic DNA-sensing pathway
    103 (ADAR)
 Human Diseases
  Infectious diseases
   05162 Measles
    103 (ADAR)
   05164 Influenza A
    103 (ADAR)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.37  double-stranded RNA adenine deaminase
     103 (ADAR)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    103 (ADAR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21.3
AA seq 1226 aa AA seqDB search
MNPRQGYSLSGYYTHPFQGYEHRQLRYQQPGPGSSPSSFLLKQIEFLKGQLPEAPVIGKQ
TPSLPPSLPGLRPRFPVLLASSTRGRQVDIRGVPRGVHLGSQGLQRGFQHPSPRGRSLPQ
RGVDCLSSHFQELSIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLA
KKGKLQKEAGTPPLWKIAVSTQAWNQHSGVVRPDGHSQGAPNSDPSLEPEDRNSTSVSED
LLEPFIAVSAQAWNQHSGVVRPDSHSQGSPNSDPGLEPEDSNSTSALEDPLEFLDMAEIK
EKICDYLFNVSDSSALNLAKNIGLTKARDINAVLIDMERQGDVYRQGTTPPIWHLTDKKR
ERMQIKRNTNSVPETAPAAIPETKRNAEFLTCNIPTSNASNNMVTTEKVENGQEPVIKLE
NRQEARPEPARLKPPVHYNGPSKAGYVDFENGQWATDDIPDDLNSIRAAPGEFRAIMEMP
SFYSHGLPRCSPYKKLTECQLKNPISGLLEYAQFASQTCEFNMIEQSGPPHEPRFKFQVV
INGREFPPAEAGSKKVAKQDAAMKAMTILLEEAKAKDSGKSEESSHYSTEKESEKTAESQ
TPTPSATSFFSGKSPVTTLLECMHKLGNSCEFRLLSKEGPAHEPKFQYCVAVGAQTFPSV
SAPSKKVAKQMAAEEAMKALHGEATNSMASDNQPEGMISESLDNLESMMPNKVRKIGELV
RYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQG
KQEAADAALRVLIGENEKAERMGFTEVTPVTGASLRRTMLLLSRSPEAQPKTLPLTGSTF
HDQIAMLSHRCFNTLTNSFQPSLLGRKILAAIIMKKDSEDMGVVVSLGTGNRCVKGDSLS
LKGETVNDCHAEIISRRGFIRFLYSELMKYNSQTAKDSIFEPAKGGEKLQIKKTVSFHLY
ISTAPCGDGALFDKSCSDRAMESTESRHYPVFENPKQGKLRTKVENGEGTIPVESSDIVP
TWDGIRLGERLRTMSCSDKILRWNVLGLQGALLTHFLQPIYLKSVTLGYLFSQGHLTRAI
CCRVTRDGSAFEDGLRHPFIVNHPKVGRVSIYDSKRQSGKTKETSVNWCLADGYDLEILD
GTRGTVDGPRNELSRVSKKNIFLLFKKLCSFRYRRDLLRLSYGEAKKAARDYETAKNYFK
KGLKDMGYGNWISKPQEEKNFYLCPV
NT seq 3681 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgcggcaggggtattccctcagcggatactacacccatccatttcaaggctat
gagcacagacagctcaggtaccagcagcctgggccaggatcttcccccagtagtttcctg
cttaagcaaatagaatttctcaaggggcagctcccagaagcaccggtgattggaaagcag
acaccgtcactgccaccttccctcccaggactccggccaaggtttccagtactacttgcc
tccagtaccagaggcaggcaagtggacatcaggggtgtccccaggggcgtgcatctcgga
agtcaggggctccagagagggttccagcatccttcaccacgtggcaggagtctgccacag
agaggtgttgattgcctttcctcacatttccaggaactgagtatctaccaagatcaggaa
caaaggatcttaaagttcctggaagagcttggggaagggaaggccaccacagcacatgat
ctgtctgggaaacttgggactccgaagaaagaaatcaatcgagttttatactccctggca
aagaagggcaagctacagaaagaggcaggaacaccccctttgtggaaaatcgcggtctcc
actcaggcttggaaccagcacagcggagtggtaagaccagacggtcatagccaaggagcc
ccaaactcagacccgagtttggaaccggaagacagaaactccacatctgtctcagaagat
cttcttgagccttttattgcagtctcagctcaggcttggaaccagcacagcggagtggta
agaccagacagtcatagccaaggatccccaaactcagacccaggtttggaacctgaagac
agcaactccacatctgccttggaagatcctcttgagtttttagacatggccgagatcaag
gagaaaatctgcgactatctcttcaatgtgtctgactcctctgccctgaatttggctaaa
aatattggccttaccaaggcccgagatataaatgctgtgctaattgacatggaaaggcag
ggggatgtctatagacaagggacaacccctcccatatggcatttgacagacaagaagcga
gagaggatgcaaatcaagagaaatacgaacagtgttcctgaaaccgctccagctgcaatc
cctgagaccaaaagaaacgcagagttcctcacctgtaatatacccacatcaaatgcctca
aataacatggtaaccacagaaaaagtggagaatgggcaggaacctgtcataaagttagaa
aacaggcaagaggccagaccagaaccagcaagactgaaaccacctgttcattacaatggc
ccctcaaaagcagggtatgttgactttgaaaatggccagtgggccacagatgacatccca
gatgacttgaatagtatccgcgcagcaccaggtgagtttcgagccatcatggagatgccc
tccttctacagtcatggcttgccacggtgttcaccctacaagaaactgacagagtgccag
ctgaagaaccccatcagcgggctgttagaatatgcccagttcgctagtcaaacctgtgag
ttcaacatgatagagcagagtggaccaccccatgaacctcgatttaaattccaggttgtc
atcaatggccgagagtttcccccagctgaagctggaagcaagaaagtggccaagcaggat
gcagctatgaaagccatgacaattctgctagaggaagccaaagccaaggacagtggaaaa
tcagaagaatcatcccactattccacagagaaagaatcagagaagactgcagagtcccag
acccccaccccttcagccacatccttcttttctgggaagagccccgtcaccacactgctt
gagtgtatgcacaaattggggaactcctgcgaattccgtctcctgtccaaagaaggccct
gcccatgaacccaagttccaatactgtgttgcagtgggagcccaaactttccccagtgtg
agtgctcccagcaagaaagtggcaaagcagatggccgcagaggaagccatgaaggccctg
catggggaggcgaccaactccatggcttctgataaccagcctgaaggtatgatctcagag
tcacttgataacttggaatccatgatgcccaacaaggtcaggaagattggcgagctcgtg
agatacctgaacaccaaccctgtgggtggccttttggagtacgcccgctcccatggcttt
gctgctgaattcaagttggtcgaccagtccggacctcctcacgagcccaagttcgtttac
caagcaaaagttgggggtcgctggttcccagccgtctgcgcacacagcaagaagcaaggc
aagcaggaagcagcagatgcggctctccgtgtcttgattggggagaacgagaaggcagaa
cgcatgggtttcacagaggtaaccccagtgacaggggccagtctcagaagaactatgctc
ctcctctcaaggtccccagaagcacagccaaagacactccctctcactggcagcaccttc
catgaccagatagccatgctgagccaccggtgcttcaacactctgactaacagcttccag
ccctccttgctcggccgcaagattctggccgccatcattatgaaaaaagactctgaggac
atgggtgtcgtcgtcagcttgggaacagggaatcgctgtgtgaaaggagattctctcagc
ctaaaaggagaaactgtcaatgactgccatgcagaaataatctcccggagaggcttcatc
aggtttctctacagtgagttaatgaaatacaactcccagactgcgaaggatagtatattt
gaacctgctaagggaggagaaaagctccaaataaaaaagactgtgtcattccatctgtat
atcagcactgctccgtgtggagatggcgccctctttgacaagtcctgcagcgaccgtgct
atggaaagcacagaatcccgccactaccctgtcttcgagaatcccaaacaaggaaagctc
cgcaccaaggtggagaacggagaaggcacaatccctgtggaatccagtgacattgtgcct
acgtgggatggcattcggctcggggagagactccgtaccatgtcctgtagtgacaaaatc
ctacgctggaacgtgctgggcctgcaaggggcactgttgacccacttcctgcagcccatt
tatctcaaatctgtcacattgggttaccttttcagccaagggcatctgacccgtgctatt
tgctgtcgtgtgacaagagatgggagtgcatttgaggatggactacgacatccctttatt
gtcaaccaccccaaggttggcagagtcagcatatatgattccaaaaggcaatccgggaag
actaaggagacaagcgtcaactggtgtctggctgatggctatgacctggagatcctggac
ggtaccagaggcactgtggatgggccacggaatgaattgtcccgggtctccaaaaagaac
atttttcttctatttaagaagctctgctccttccgttaccgcagggatctactgagactc
tcctatggtgaggccaagaaagctgcccgtgactacgagacggccaagaactacttcaaa
aaaggcctgaaggatatgggctatgggaactggattagcaaaccccaggaggaaaagaac
ttttatctctgcccagtatag

DBGET integrated database retrieval system