KEGG   Homo sapiens (human): 1031Help
Entry
1031              CDS       T01001                                 

Gene name
CDKN2C, INK4C, p18, p18-INK4C
Definition
cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4)
Orthology
K06622  
cyclin-dependent kinase inhibitor 2C
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
HTLV-I infection
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    1031 (CDKN2C)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    1031 (CDKN2C)
  Infectious diseases
   05166 HTLV-I infection
    1031 (CDKN2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p32
AA seq 168 aa AA seqDB search
MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRG
ANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVE
FLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggccgagccttgggggaacgagttggcgtccgcagctgccaggggggacctagagcaa
cttactagtttgttgcaaaataatgtaaacgtcaatgcacaaaatggatttggaaggact
gcgctgcaggttatgaaacttggaaatcccgagattgccaggagactgctacttagaggt
gctaatcccgatttgaaagaccgaactggtttcgctgtcattcatgatgcggccagagca
ggtttcctggacactttacagactttgctggagtttcaagctgatgttaacatcgaggat
aatgaagggaacctgcccttgcacttggctgccaaagaaggccacctccgggtggtggag
ttcctggtgaagcacacggccagcaatgtggggcatcggaaccataagggggacaccgcc
tgtgatttggccaggctctatgggaggaatgaggttgttagcctgatgcaggcaaacggg
gctgggggagccacaaatcttcaataa

DBGET integrated database retrieval system