KEGG   Homo sapiens (human): 1031Help
Entry
1031              CDS       T01001                                 

Gene name
CDKN2C, INK4C, p18, p18-INK4C
Definition
(RefSeq) cyclin dependent kinase inhibitor 2C
  KO
K06622  cyclin-dependent kinase inhibitor 2C
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04110  Cell cycle
hsa04934  Cushing's syndrome
hsa05166  HTLV-I infection
hsa05202  Transcriptional misregulation in cancer
Network
N00120  MLL-ENL fusion to transcriptional activation
N00290  Mutation-inactivated MEN1 to transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    1031 (CDKN2C)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    1031 (CDKN2C)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    1031 (CDKN2C)
  Infectious diseases
   05166 HTLV-I infection
    1031 (CDKN2C)
  Drug resistance
   01522 Endocrine resistance
    1031 (CDKN2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank Ank_3 DUF1843
Motif
Other DBs
NCBI-GeneID: 1031
NCBI-ProteinID: NP_001253
OMIM: 603369
HGNC: 1789
Ensembl: ENSG00000123080
Vega: OTTHUMG00000008046
Pharos: P42773(Tbio)
UniProt: P42773 Q6ICV4
Structure
PDB: 

Jmol
Position
1p32.3
AA seq 168 aa AA seqDB search
MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRG
ANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVE
FLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggccgagccttgggggaacgagttggcgtccgcagctgccaggggggacctagagcaa
cttactagtttgttgcaaaataatgtaaacgtcaatgcacaaaatggatttggaaggact
gcgctgcaggttatgaaacttggaaatcccgagattgccaggagactgctacttagaggt
gctaatcccgatttgaaagaccgaactggtttcgctgtcattcatgatgcggccagagca
ggtttcctggacactttacagactttgctggagtttcaagctgatgttaacatcgaggat
aatgaagggaacctgcccttgcacttggctgccaaagaaggccacctccgggtggtggag
ttcctggtgaagcacacggccagcaatgtggggcatcggaaccataagggggacaccgcc
tgtgatttggccaggctctatgggaggaatgaggttgttagcctgatgcaggcaaacggg
gctgggggagccacaaatcttcaataa

DBGET integrated database retrieval system