KEGG   Homo sapiens (human): 10312Help
Entry
10312             CDS       T01001                                 

Gene name
TCIRG1, ATP6N1C, ATP6V0A3, Atp6i, OC-116kDa, OC116, OPTB1, Stv1, TIRC7, Vph1, a3
Definition
T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3 (EC:3.6.3.6)
Orthology
K02154  
V-type H+-transporting ATPase subunit a
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Lysosome
Phagosome
Synaptic vesicle cycle
Collecting duct acid secretion
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Tuberculosis
Rheumatoid arthritis
Module
V-type ATPase, eukaryotes
Disease
H00436  
Osteopetrosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    10312 (TCIRG1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    10312 (TCIRG1)
   04142 Lysosome
    10312 (TCIRG1)
 Organismal Systems
  Excretory system
   04966 Collecting duct acid secretion
    10312 (TCIRG1)
  Nervous system
   04721 Synaptic vesicle cycle
    10312 (TCIRG1)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    10312 (TCIRG1)
  Infectious diseases
   05110 Vibrio cholerae infection
    10312 (TCIRG1)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    10312 (TCIRG1)
   05152 Tuberculosis
    10312 (TCIRG1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   10312 (TCIRG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13.2
AA seq 830 aa AA seqDB search
MGSMFRSEEVALVQLFLPTAAAYTCVSRLGELGLVEFRDLNASVSAFQRRFVVDVRRCEE
LEKTFTFLQEEVRRAGLVLPPPKGRLPAPPPRDLLRIQEETERLAQELRDVRGNQQALRA
QLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAP
ALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFLISYWGEQIGQKIRKITDCFH
CHVFPFLQQEEARLGALQQLQQQSQELQEVLGETERFLSQVLGRVLQLLPPGQVQVHKMK
AVYLALNQCSVSTTHKCLIAEAWCSVRDLPALQEALRDSSMEEGVSAVAHRIPCRDMPPT
LIRTNRFTASFQGIVDAYGVGRYQEVNPAPYTIITFPFLFAVMFGDVGHGLLMFLFALAM
VLAENRPAVKAAQNEIWQTFFRGRYLLLLMGLFSIYTGFIYNECFSRATSIFPSGWSVAA
MANQSGWSDAFLAQHTMLTLDPNVTGVFLGPYPFGIDPIWSLAANHLSFLNSFKMKMSVI
LGVVHMAFGVVLGVFNHVHFGQRHRLLLETLPELTFLLGLFGYLVFLVIYKWLCVWAARA
ASAPSILIHFINMFLFSHSPSNRLLYPRQEVVQATLVVLALAMVPILLLGTPLHLLHRHR
RRLRRRPADRQEENKAGLLDLPDASVNGWSSDEEKAGGLDDEEEAELVPSEVLMHQAIHT
IEFCLGCVSNTASYLRLWALSLAHAQLSEVLWAMVMRIGLGLGREVGVAAVVLVPIFAAF
AVMTVAILLVMEGLSAFLHALRLHWVEFQNKFYSGTGYKLSPFTFAATDD
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atgggctccatgttccggagcgaggaggtggccctggtccagctctttctgcccacagcg
gctgcctacacctgcgtgagtcggctgggcgagctgggcctcgtggagttcagagacctc
aacgcctcggtgagcgccttccagagacgctttgtggttgatgttcggcgctgtgaggag
ctggagaagaccttcaccttcctgcaggaggaggtgcggcgggctgggctggtcctgccc
ccgccaaaggggaggctgccggcacccccaccccgggacctgctgcgcatccaggaggag
acggagcgcctggcccaggagctgcgggatgtgcggggcaaccagcaggccctgcgggcc
cagctgcaccagctgcagctccacgccgccgtgctacgccagggccatgaacctcagctg
gcagccgcccacacagatggggcctcagagaggacgcccctgctccaggcccccgggggg
ccgcaccaggacctgagggtcaactttgtggcaggtgccgtggagccccacaaggcccct
gccctagagcgcctgctctggagggcctgccgcggcttcctcattgccagcttcagggag
ctggagcagccgctggagcaccccgtgacgggcgagccagccacgtggatgaccttcctc
atctcctactggggtgagcagatcggacagaagatccgcaagatcacggactgcttccac
tgccacgtcttcccgtttctgcagcaggaggaggcccgcctcggggccctgcagcagctg
caacagcagagccaggagctgcaggaggtcctcggggagacagagcggttcctgagccag
gtgctaggccgggtgctgcagctgctgccgccagggcaggtgcaggtccacaagatgaag
gccgtgtacctggccctgaaccagtgcagcgtgagcaccacgcacaagtgcctcattgcc
gaggcctggtgctctgtgcgagacctgcccgccctgcaggaggccctgcgggacagctcg
atggaggagggagtgagtgccgtggctcaccgcatcccctgccgggacatgccccccaca
ctcatccgcaccaaccgcttcacggccagcttccagggcatcgtggatgcctacggcgtg
ggccgctaccaggaggtcaaccccgctccctacaccatcatcaccttccccttcctgttt
gctgtgatgttcggggatgtgggccacgggctgctcatgttcctcttcgccctggccatg
gtccttgcggagaaccgaccggctgtgaaggccgcgcagaacgagatctggcagactttc
ttcaggggccgctacctgctcctgcttatgggcctgttctccatctacaccggcttcatc
tacaacgagtgcttcagtcgcgccaccagcatcttcccctcgggctggagtgtggccgcc
atggccaaccagtctggctggagtgatgcattcctggcccagcacacgatgcttaccctg
gatcccaacgtcaccggtgtcttcctgggaccctacccctttggcatcgatcctatttgg
agcctggctgccaaccacttgagcttcctcaactccttcaagatgaagatgtccgtcatc
ctgggcgtcgtgcacatggcctttggggtggtcctcggagtcttcaaccacgtgcacttt
ggccagaggcaccggctgctgctggagacgctgccggagctcaccttcctgctgggactc
ttcggttacctcgtgttcctagtcatctacaagtggctgtgtgtctgggctgccagggcc
gcctcggcccccagcatcctcatccacttcatcaacatgttcctcttctcccacagcccc
agcaacaggctgctctacccccggcaggaggtggtccaggccacgctggtggtcctggcc
ttggccatggtgcccatcctgctgcttggcacacccctgcacctgctgcaccgccaccgc
cgccgcctgcggaggaggcccgctgaccgacaggaggaaaacaaggccgggttgctggac
ctgcctgacgcatctgtgaatggctggagctccgatgaggaaaaggcagggggcctggat
gatgaagaggaggccgagctcgtcccctccgaggtgctcatgcaccaggccatccacacc
atcgagttctgcctgggctgcgtctccaacaccgcctcctacctgcgcctgtgggccctg
agcctggcccacgcccagctgtccgaggttctgtgggccatggtgatgcgcataggcctg
ggcctgggccgggaggtgggcgtggcggctgtggtgctggtccccatctttgccgccttt
gccgtgatgaccgtggctatcctgctggtgatggagggactctcagccttcctgcacgcc
ctgcggctgcactgggtggaattccagaacaagttctactcaggcacgggctacaagctg
agtcccttcaccttcgctgccacagatgactag

DBGET integrated database retrieval system