KEGG   Homo sapiens (human): 10316Help
Entry
10316             CDS       T01001                                 

Gene name
NMUR1, (FM-3), FM-3, FM3, GPC-R, GPR66, NMU1R
Definition
neuromedin U receptor 1
Orthology
K05052  
neuromedin U receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q37.1
AA seq 426 aa AA seqDB search
MTPLCLNCSVLPGDLYPGGARNPMACNGSAARGHFDPEDLNLTDEALRLKYLGPQQTELF
MPICATYLLIFVVGAVGNGLTCLVILRHKAMRTPTNYYLFSLAVSDLLVLLVGLPLELYE
MWHNYPFLLGVGGCYFRTLLFEMVCLASVLNVTALSVERYVAVVHPLQARSMVTRAHVRR
VLGAVWGLAMLCSLPNTSLHGIRQLHVPCRGPVPDSAVCMLVRPRALYNMVVQTTALLFF
CLPMAIMSVLYLLIGLRLRRERLLLMQEAKGRGSAAARSRYTCRLQQHDRGRRQVTKMLF
VLVVVFGICWAPFHADRVMWSVVSQWTDGLHLAFQHVHVISGIFFYLGSAANPVLYSLMS
SRFRETFQEALCLGACCHRLRPRHSSHSLSRMTTGSTLCDVGSLGSWVHPLAGNDGPEAQ
QETDPS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgactcctctctgcctcaattgctctgtcctccctggagacctgtacccagggggtgca
aggaaccccatggcttgcaatggcagtgcggccagggggcactttgaccctgaggacttg
aacctgactgacgaggcactgagactcaagtacctggggccccagcagacagagctgttc
atgcccatctgtgccacatacctgctgatcttcgtggtgggcgctgtgggcaatgggctg
acctgtctggtcatcctgcgccacaaggccatgcgcacgcctaccaactactacctcttc
agcctggccgtgtcggacctgctggtgctgctggtgggcctgcccctggagctctatgag
atgtggcacaactaccccttcctgctgggcgttggtggctgctatttccgcacgctactg
tttgagatggtctgcctggcctcagtgctcaacgtcactgccctgagcgtggaacgctat
gtggccgtggtgcacccactccaggccaggtccatggtgacgcgggcccatgtgcgccga
gtgcttggggccgtctggggtcttgccatgctctgctccctgcccaacaccagcctgcac
ggcatccggcagctgcacgtgccctgccggggcccagtgccagactcagctgtttgcatg
ctggtccgcccacgggccctctacaacatggtagtgcagaccaccgcgctgctcttcttc
tgcctgcccatggccatcatgagcgtgctctacctgctcattgggctgcgactgcggcgg
gagaggctgctgctcatgcaggaggccaagggcaggggctctgcagcagccaggtccaga
tacacctgcaggctccagcagcacgatcggggccggagacaagtgaccaagatgctgttt
gtcctggtcgtggtgtttggcatctgctgggccccgttccacgccgaccgcgtcatgtgg
agcgtcgtgtcacagtggacagatggcctgcacctggccttccagcacgtgcacgtcatc
tccggcatcttcttctacctgggctcggcggccaaccccgtgctctatagcctcatgtcc
agccgcttccgagagaccttccaggaggccctgtgcctcggggcctgctgccatcgcctc
agaccccgccacagctcccacagcctcagcaggatgaccacaggcagcaccctgtgtgat
gtgggctccctgggcagctgggtccaccccctggctgggaacgatggcccagaggcgcag
caagagaccgatccatcctga

DBGET integrated database retrieval system