KEGG   Homo sapiens (human): 10326Help
Entry
10326             CDS       T01001                                 

Gene name
SIRPB1, CD172b, SIRP-BETA-1
Definition
(RefSeq) signal regulatory protein beta 1
  KO
K06551  
signal-regulatory protein alpha/beta1/gamma
Organism
hsa  Homo sapiens (human)
Pathway
Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    10326 (SIRPB1)
CD molecules [BR:hsa04090]
 Proteins
  10326 (SIRPB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q5TFQ8(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
20p13
AA seq 398 aa AA seqDB search
MPVPASWPHLPSPFLLMTLLLGRLTGVAGEEELQVIQPDKSISVAAGESATLHCTVTSLI
PVGPIQWFRGAGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISNITPADAGTYYC
VKFRKGSPDHVEFKSGAGTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDIT
LKWFKNGNELSDFQTNVDPAGDSVSYSIHSTAKVVLTREDVHSQVICEVAHVTLQGDPLR
GTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRKFYPQRLQLTWLENGNVSRTETAST
LTENKDGTYNWMSWLLVNVSAHRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTA
PGPALASAAPLLIAFLLGPKVLLVVGVSVIYVYWKQKA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtgccagcctcctggccccaccttcctagtcctttcctgctgatgacgctactg
ctggggagactcacaggggtagctggcgaggaagagctgcaggtgattcagcctgacaag
tccatatcagttgcagctggagagtcggccactctgcactgcactgtgacttccctgatc
cctgtggggcccatccagtggttcagaggagctggaccaggccgggaattaatctacaat
cagaaagaaggccacttcccacgggtaacaactgtttcagacctcacaaagagaaacaac
atggacttttccatccgcatcagtaacatcaccccagcagatgccggcacctactactgt
gtgaagttccggaaagggagccccgaccacgtggagtttaagtctggagcaggcaccgag
ctgtctgtgcgtgccaaaccctctgcccccgtggtatcgggccctgcggcgagggccaca
cctcagcacacagtgagcttcacctgcgagtcccacggcttctcacccagagacatcacc
ctgaaatggttcaaaaatgggaatgagctctcagacttccagaccaacgtggaccccgca
ggagacagtgtgtcctacagcatccacagcacagccaaggtggtgctgacccgcgaggac
gttcactctcaagtcatctgcgaggtggcccacgtcaccttgcagggggaccctcttcgt
gggactgccaacttgtctgagaccatccgagttccacccaccttggaggttactcaacag
cccgtgagggcagagaaccaggtgaatgtcacctgccaggtgaggaagttctacccccag
agactacagctgacctggttggagaatggaaacgtgtccaggacagaaacggcctcaacc
cttacagaaaacaaggatggtacctacaactggatgagctggctcctggtgaatgtatct
gcccacagggatgatgtgaagctcacctgccaggtggagcatgacgggcagccagcggtc
agcaaaagccatgacctgaaggtctcagcccacccgaaggagcagggctcaaatactgct
cctggcccagcactggcttctgctgctccacttctcatagctttcctcctgggccccaag
gtgctgctggtggttggtgtctctgtcatctatgtctactggaagcagaaggcctga

DBGET integrated database retrieval system