KEGG   Homo sapiens (human): 10326Help
Entry
10326             CDS       T01001                                 

Gene name
SIRPB1, CD172b, SIRP-BETA-1
Definition
(RefSeq) signal regulatory protein beta 1
  KO
K06551  signal-regulatory protein alpha/beta1/gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    10326 (SIRPB1)
CD molecules [BR:hsa04090]
 Proteins
  10326 (SIRPB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C1-set Ig_3 C2-set_2 V-set ig Ig_2 I-set Eryth_link_C
Motif
Other DBs
NCBI-GeneID: 10326
NCBI-ProteinID: NP_001129316
OMIM: 603889
HGNC: 15928
Ensembl: ENSG00000101307
Vega: OTTHUMG00000031676
Pharos: Q5TFQ8(Tbio)
UniProt: Q5TFQ8
Structure
PDB: 

Jmol
Position
20p13
AA seq 398 aa AA seqDB search
MPVPASWPHLPSPFLLMTLLLGRLTGVAGEEELQVIQPDKSISVAAGESATLHCTVTSLI
PVGPIQWFRGAGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISNITPADAGTYYC
VKFRKGSPDHVEFKSGAGTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDIT
LKWFKNGNELSDFQTNVDPAGDSVSYSIHSTAKVVLTREDVHSQVICEVAHVTLQGDPLR
GTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRKFYPQRLQLTWLENGNVSRTETAST
LTENKDGTYNWMSWLLVNVSAHRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTA
PGPALASAAPLLIAFLLGPKVLLVVGVSVIYVYWKQKA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtgccagcctcctggccccaccttcctagtcctttcctgctgatgacgctactg
ctggggagactcacaggggtagctggcgaggaagagctgcaggtgattcagcctgacaag
tccatatcagttgcagctggagagtcggccactctgcactgcactgtgacttccctgatc
cctgtggggcccatccagtggttcagaggagctggaccaggccgggaattaatctacaat
cagaaagaaggccacttcccacgggtaacaactgtttcagacctcacaaagagaaacaac
atggacttttccatccgcatcagtaacatcaccccagcagatgccggcacctactactgt
gtgaagttccggaaagggagccccgaccacgtggagtttaagtctggagcaggcaccgag
ctgtctgtgcgtgccaaaccctctgcccccgtggtatcgggccctgcggcgagggccaca
cctcagcacacagtgagcttcacctgcgagtcccacggcttctcacccagagacatcacc
ctgaaatggttcaaaaatgggaatgagctctcagacttccagaccaacgtggaccccgca
ggagacagtgtgtcctacagcatccacagcacagccaaggtggtgctgacccgcgaggac
gttcactctcaagtcatctgcgaggtggcccacgtcaccttgcagggggaccctcttcgt
gggactgccaacttgtctgagaccatccgagttccacccaccttggaggttactcaacag
cccgtgagggcagagaaccaggtgaatgtcacctgccaggtgaggaagttctacccccag
agactacagctgacctggttggagaatggaaacgtgtccaggacagaaacggcctcaacc
cttacagaaaacaaggatggtacctacaactggatgagctggctcctggtgaatgtatct
gcccacagggatgatgtgaagctcacctgccaggtggagcatgacgggcagccagcggtc
agcaaaagccatgacctgaaggtctcagcccacccgaaggagcagggctcaaatactgct
cctggcccagcactggcttctgctgctccacttctcatagctttcctcctgggccccaag
gtgctgctggtggttggtgtctctgtcatctatgtctactggaagcagaaggcctga

DBGET integrated database retrieval system