KEGG   Homo sapiens (human): 1033Help
Entry
1033              CDS       T01001                                 

Gene name
CDKN3, CDI1, CIP2, KAP, KAP1
Definition
(RefSeq) cyclin dependent kinase inhibitor 3 (EC:3.1.3.16 3.1.3.48)
  KO
K14167  
cyclin-dependent kinase inhibitor 3 [EC:3.1.3.16 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     1033 (CDKN3)
    3.1.3.48  protein-tyrosine-phosphatase
     1033 (CDKN3)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   CDC14
    1033 (CDKN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q22
AA seq 212 aa AA seqDB search
MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNV
QKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCC
EIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAI
QTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgcccagttcaatacaaacaagtgagtttgactcatcagatgaagagcctatt
gaagatgaacagactccaattcatatatcatggctatctttgtcacgagtgaattgttct
cagtttctcggtttatgtgctcttccaggttgtaaatttaaagatgttagaagaaatgtc
caaaaagatacagaagaactaaagagctgtggtatacaagacatatttgttttctgcacc
agaggggaactgtcaaaatatagagtcccaaaccttctggatctctaccagcaatgtgga
attatcacccatcatcatccaatcgcagatggagggactcctgacatagccagctgctgt
gaaataatggaagagcttacaacctgccttaaaaattaccgaaaaaccttaatacactgc
tatggaggacttgggagatcttgtcttgtagctgcttgtctcctactatacctgtctgac
acaatatcaccagagcaagccatagacagcctgcgagacctaagaggatccggggcaata
cagaccatcaagcaatacaattatcttcatgagtttcgggacaaattagctgcacatcta
tcatcaagagattcacaatcaagatctgtatcaagataa

DBGET integrated database retrieval system