KEGG   Homo sapiens (human): 10333Help
Entry
10333             CDS       T01001                                 

Gene name
TLR6, CD286
Definition
toll-like receptor 6
Orthology
K10169  
toll-like receptor 6
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Toll-like receptor signaling pathway
Chagas disease (American trypanosomiasis)
Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    10333 (TLR6)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    10333 (TLR6)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    10333 (TLR6)
   05142 Chagas disease (American trypanosomiasis)
    10333 (TLR6)
Cellular antigens [BR:hsa04090]
 Proteins
  10333 (TLR6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
4p14
AA seq 796 aa AA seqDB search
MTKDKEPIVKSFHFVCLMIIIVGTRIQFSDGNEFAVDKSKRGLIHVPKDLPLKTKVLDMS
QNYIAELQVSDMSFLSELTVLRLSHNRIQLLDLSVFKFNQDLEYLDLSHNQLQKISCHPI
VSFRHLDLSFNDFKALPICKEFGNLSQLNFLGLSAMKLQKLDLLPIAHLHLSYILLDLRN
YYIKENETESLQILNAKTLHLVFHPTSLFAIQVNISVNTLGCLQLTNIKLNDDNCQVFIK
FLSELTRGSTLLNFTLNHIETTWKCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYS
KTTLKALTIEHITNQVFLFSQTALYTVFSEMNIMMLTISDTPFIHMLCPHAPSTFKFLNF
TQNVFTDSIFEKCSTLVKLETLILQKNGLKDLFKVGLMTKDMPSLEILDVSWNSLESGRH
KENCTWVESIVVLNLSSNMLTDSVFRCLPPRIKVLDLHSNKIKSVPKQVVKLEALQELNV
AFNSLTDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELREF
VKNIDQVSSEVLEGWPDSYKCDYPESYRGSPLKDFHMSELSCNITLLIVTIGATMLVLAV
TVTSLCIYLDLPWYLRMVCQWTQTRRRARNIPLEELQRNLQFHAFISYSEHDSAWVKSEL
VPYLEKEDIQICLHERNFVPGKSIVENIINCIEKSYKSIFVLSPNFVQSEWCHYELYFAH
HNLFHEGSNNLILILLEPIPQNSIPNKYHKLKALMTQRTYLQWPKEKSKRGLFWANIRAA
FNMKLTLVTENNDVKS
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagacaaagaacctattgttaaaagcttccattttgtttgccttatgatcata
atagttggaaccagaatccagttctccgacggaaatgaatttgcagtagacaagtcaaaa
agaggtcttattcatgttccaaaagacctaccgctgaaaaccaaagtcttagatatgtct
cagaactacatcgctgagcttcaggtctctgacatgagctttctatcagagttgacagtt
ttgagactttcccataacagaatccagctacttgatttaagtgttttcaagttcaaccag
gatttagaatatttggatttatctcataatcagttgcaaaagatatcctgccatcctatt
gtgagtttcaggcatttagatctctcattcaatgatttcaaggccctgcccatctgtaag
gaatttggcaacttatcacaactgaatttcttgggattgagtgctatgaagctgcaaaaa
ttagatttgctgccaattgctcacttgcatctaagttatatccttctggatttaagaaat
tattatataaaagaaaatgagacagaaagtctacaaattctgaatgcaaaaacccttcac
cttgtttttcacccaactagtttattcgctatccaagtgaacatatcagttaatacttta
gggtgcttacaactgactaatattaaattgaatgatgacaactgtcaagttttcattaaa
tttttatcagaactcaccagaggttcaaccttactgaattttaccctcaaccacatagaa
acgacttggaaatgcctggtcagagtctttcaatttctttggcccaaacctgtggaatat
ctcaatatttacaatttaacaataattgaaagcattcgtgaagaagattttacttattct
aaaacgacattgaaagcattgacaatagaacatatcacgaaccaagtttttctgttttca
cagacagctttgtacaccgtgttttctgagatgaacattatgatgttaaccatttcagat
acaccttttatacacatgctgtgtcctcatgcaccaagcacattcaagtttttgaacttt
acccagaacgttttcacagatagtatttttgaaaaatgttccacgttagttaaattggag
acacttatcttacaaaagaatggattaaaagaccttttcaaagtaggtctcatgacgaag
gatatgccttctttggaaatactggatgttagctggaattctttggaatctggtagacat
aaagaaaactgcacttgggttgagagtatagtggtgttaaatttgtcttcaaatatgctt
actgactctgttttcagatgtttacctcccaggatcaaggtacttgatcttcacagcaat
aaaataaagagcgttcctaaacaagtcgtaaaactggaagctttgcaagaactcaatgtt
gctttcaattctttaactgaccttcctggatgtggcagctttagcagcctttctgtattg
atcattgatcacaattcagtttcccacccatcggctgatttcttccagagctgccagaag
atgaggtcaataaaagcaggggacaatccattccaatgtacctgtgagctaagagaattt
gtcaaaaatatagaccaagtatcaagtgaagtgttagagggctggcctgattcttataag
tgtgactacccagaaagttatagaggaagcccactaaaggactttcacatgtctgaatta
tcctgcaacataactctgctgatcgtcaccatcggtgccaccatgctggtgttggctgtg
actgtgacctccctctgcatctacttggatctgccctggtatctcaggatggtgtgccag
tggacccagactcggcgcagggccaggaacatacccttagaagaactccaaagaaacctc
cagtttcatgcttttatttcatatagtgaacatgattctgcctgggtgaaaagtgaattg
gtaccttacctagaaaaagaagatatacagatttgtcttcatgagagaaactttgtccct
ggcaagagcattgtggaaaatatcatcaactgcattgagaagagttacaagtccatcttt
gttttgtctcccaactttgtccagagtgagtggtgccattacgaactctattttgcccat
cacaatctctttcatgaaggatctaataacttaatcctcatcttactggaacccattcca
cagaacagcattcccaacaagtaccacaagctgaaggctctcatgacgcagcggacttat
ttgcagtggcccaaggagaaaagcaaacgtgggctcttttgggctaacattagagccgct
tttaatatgaaattaacactagtcactgaaaacaatgatgtgaaatcttaa

DBGET integrated database retrieval system