KEGG   Homo sapiens (human): 10333Help
Entry
10333             CDS       T01001                                 

Gene name
TLR6, CD286
Definition
(RefSeq) toll like receptor 6
  KO
K10169  toll-like receptor 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04620  Toll-like receptor signaling pathway
hsa05142  Chagas disease (American trypanosomiasis)
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    10333 (TLR6)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    10333 (TLR6)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    10333 (TLR6)
   05142 Chagas disease (American trypanosomiasis)
    10333 (TLR6)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    10333 (TLR6)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   10333 (TLR6)
CD molecules [BR:hsa04090]
 Proteins
  10333 (TLR6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR LRR_8 LRR_4 TIR_2 LRR_6 LRR_9 LRRCT TIR-like
Motif
Other DBs
NCBI-GeneID: 10333
NCBI-ProteinID: NP_006059
OMIM: 605403
HGNC: 16711
Ensembl: ENSG00000174130
Vega: OTTHUMG00000128579
Pharos: Q9Y2C9(Tbio)
UniProt: Q9Y2C9 B2R933
Structure
PDB: 

Jmol
Position
4p14
AA seq 796 aa AA seqDB search
MTKDKEPIVKSFHFVCLMIIIVGTRIQFSDGNEFAVDKSKRGLIHVPKDLPLKTKVLDMS
QNYIAELQVSDMSFLSELTVLRLSHNRIQLLDLSVFKFNQDLEYLDLSHNQLQKISCHPI
VSFRHLDLSFNDFKALPICKEFGNLSQLNFLGLSAMKLQKLDLLPIAHLHLSYILLDLRN
YYIKENETESLQILNAKTLHLVFHPTSLFAIQVNISVNTLGCLQLTNIKLNDDNCQVFIK
FLSELTRGSTLLNFTLNHIETTWKCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYS
KTTLKALTIEHITNQVFLFSQTALYTVFSEMNIMMLTISDTPFIHMLCPHAPSTFKFLNF
TQNVFTDSIFEKCSTLVKLETLILQKNGLKDLFKVGLMTKDMPSLEILDVSWNSLESGRH
KENCTWVESIVVLNLSSNMLTDSVFRCLPPRIKVLDLHSNKIKSVPKQVVKLEALQELNV
AFNSLTDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELREF
VKNIDQVSSEVLEGWPDSYKCDYPESYRGSPLKDFHMSELSCNITLLIVTIGATMLVLAV
TVTSLCIYLDLPWYLRMVCQWTQTRRRARNIPLEELQRNLQFHAFISYSEHDSAWVKSEL
VPYLEKEDIQICLHERNFVPGKSIVENIINCIEKSYKSIFVLSPNFVQSEWCHYELYFAH
HNLFHEGSNNLILILLEPIPQNSIPNKYHKLKALMTQRTYLQWPKEKSKRGLFWANIRAA
FNMKLTLVTENNDVKS
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagacaaagaacctattgttaaaagcttccattttgtttgccttatgatcata
atagttggaaccagaatccagttctccgacggaaatgaatttgcagtagacaagtcaaaa
agaggtcttattcatgttccaaaagacctaccgctgaaaaccaaagtcttagatatgtct
cagaactacatcgctgagcttcaggtctctgacatgagctttctatcagagttgacagtt
ttgagactttcccataacagaatccagctacttgatttaagtgttttcaagttcaaccag
gatttagaatatttggatttatctcataatcagttgcaaaagatatcctgccatcctatt
gtgagtttcaggcatttagatctctcattcaatgatttcaaggccctgcccatctgtaag
gaatttggcaacttatcacaactgaatttcttgggattgagtgctatgaagctgcaaaaa
ttagatttgctgccaattgctcacttgcatctaagttatatccttctggatttaagaaat
tattatataaaagaaaatgagacagaaagtctacaaattctgaatgcaaaaacccttcac
cttgtttttcacccaactagtttattcgctatccaagtgaacatatcagttaatacttta
gggtgcttacaactgactaatattaaattgaatgatgacaactgtcaagttttcattaaa
tttttatcagaactcaccagaggttcaaccttactgaattttaccctcaaccacatagaa
acgacttggaaatgcctggtcagagtctttcaatttctttggcccaaacctgtggaatat
ctcaatatttacaatttaacaataattgaaagcattcgtgaagaagattttacttattct
aaaacgacattgaaagcattgacaatagaacatatcacgaaccaagtttttctgttttca
cagacagctttgtacaccgtgttttctgagatgaacattatgatgttaaccatttcagat
acaccttttatacacatgctgtgtcctcatgcaccaagcacattcaagtttttgaacttt
acccagaacgttttcacagatagtatttttgaaaaatgttccacgttagttaaattggag
acacttatcttacaaaagaatggattaaaagaccttttcaaagtaggtctcatgacgaag
gatatgccttctttggaaatactggatgttagctggaattctttggaatctggtagacat
aaagaaaactgcacttgggttgagagtatagtggtgttaaatttgtcttcaaatatgctt
actgactctgttttcagatgtttacctcccaggatcaaggtacttgatcttcacagcaat
aaaataaagagcgttcctaaacaagtcgtaaaactggaagctttgcaagaactcaatgtt
gctttcaattctttaactgaccttcctggatgtggcagctttagcagcctttctgtattg
atcattgatcacaattcagtttcccacccatcggctgatttcttccagagctgccagaag
atgaggtcaataaaagcaggggacaatccattccaatgtacctgtgagctaagagaattt
gtcaaaaatatagaccaagtatcaagtgaagtgttagagggctggcctgattcttataag
tgtgactacccagaaagttatagaggaagcccactaaaggactttcacatgtctgaatta
tcctgcaacataactctgctgatcgtcaccatcggtgccaccatgctggtgttggctgtg
actgtgacctccctctgcatctacttggatctgccctggtatctcaggatggtgtgccag
tggacccagactcggcgcagggccaggaacatacccttagaagaactccaaagaaacctc
cagtttcatgcttttatttcatatagtgaacatgattctgcctgggtgaaaagtgaattg
gtaccttacctagaaaaagaagatatacagatttgtcttcatgagagaaactttgtccct
ggcaagagcattgtggaaaatatcatcaactgcattgagaagagttacaagtccatcttt
gttttgtctcccaactttgtccagagtgagtggtgccattacgaactctattttgcccat
cacaatctctttcatgaaggatctaataacttaatcctcatcttactggaacccattcca
cagaacagcattcccaacaagtaccacaagctgaaggctctcatgacgcagcggacttat
ttgcagtggcccaaggagaaaagcaaacgtgggctcttttgggctaacattagagccgct
tttaatatgaaattaacactagtcactgaaaacaatgatgtgaaatcttaa

DBGET integrated database retrieval system