KEGG   Homo sapiens (human): 10335Help
Entry
10335             CDS       T01001                                 

Gene name
MRVI1, IRAG, JAW1L
Definition
murine retrovirus integration site 1 homolog
Orthology
K12337  
inositol 1,4,5-triphosphate receptor-associated cGMP kinase substrate
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    10335 (MRVI1)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    10335 (MRVI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15
AA seq 904 aa AA seqDB search
MGMDLTCPFGISPACGAQASWSIFGADAAEVPGTRGHSQQEAAMPHIPEDEEPPGEPQAA
QSPAGQGPPAAGVSCSPTPTIVLTGDATSPEGETDKNLANRVHSPHKRLSHRHLKVSTAS
LTSVDPAGHIIDLVNDQLPDISISEEDKKKNLALLEEAKLVSERFLTRRGRKSRSSPGDS
PSAVSPNLSPSASPTSSRSNSLTVPTPPGLDVCSGPPSPLPGAPPQQKGDEADVSSPHPG
EPNVPKGLADRKQNDQRKVSQGRLAPRPPPVEKSKEIAIEQKENFDPLQYPETTPKGLAP
VTNSSGKMALNSPQPGPVESELGKQLLKTGWEGSPLPRSPTQDAAGVGPPASQGRGPAGE
PMGPEAGSKAELPPTVSRPPLLRGLSWDSGPEEPGPRLQKVLAKLPLAEEEKRFAGKAGG
KLAKAPGLKDFQIQVQPVRMQKLTKLREEHILMRNQNLVGLKLPDLSEAAEQEKGLPSEL
SPAIEEEESKSGLDVMPNISDVLLRKLRVHRSLPGSAPPLTEKEVENVFVQLSLAFRNDS
YTLESRINQAERERNLTEENTEKELENFKASITSSASLWHHCEHRETYQKLLEDIAVLHR
LAARLSSRAEVVGAVRQEKRMSKATEVMMQYVENLKRTYEKDHAELMEFKKLANQNSSRS
CGPSEDGVPRTARSMSLTLGKNMPRRRVSVAVVPKFNALNLPGQTPSSSSIPSLPALSES
PNGKGSLPVTSALPALLENGKTNGDPDCEASAPALTLSCLEELSQETKARMEEEAYSKGF
QEGLKKTKELQDLKEEEEEQKSESPEEPEEVEETEEEEKGPRSSKLEELVHFLQVMYPKL
CQHWQVIWMMAAVMLVLTVVLGLYNSYNSCAEQADGPLGRSTCSAAQRDSWWSSGLQHEQ
PTEQ
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgggaatggatttgacttgtccttttggcatctccccagcctgtggagcccaggcctct
tggagcatctttggggctgacgcagcggaggttccgggcacacgtggccactcccagcag
gaggctgccatgccccacattcccgaggacgaggagccccccggagagccacaggcagcc
cagagccctgccggccaaggtcctcctgccgcaggagtatcttgcagtccaactcccacg
attgtcctgactggggatgccacttcaccagaaggagaaaccgacaaaaacctggccaac
agagttcacagtccccacaagaggctttctcaccgacacttgaaggtgtccactgcctcc
ctgacatctgtggaccccgcggggcacatcattgacctggtgaatgaccagctgccagac
atcagcatctcagaggaggacaagaagaaaaacctggcgctgctggaagaagccaagttg
gtgagtgagcgattcctgacccgccgtgggaggaagtccaggagcagccccggagactcc
ccatcagctgtttccccgaacctcagccccagcgcttctcctacatcctctcggagcaac
tcacttacagtccccaccccgccaggtttggatgtgtgcagtggcccgccatcccctctg
cctggagcaccaccacagcagaagggggatgaggccgacgtctcttcacctcaccctggc
gagcctaacgtccccaaagggctagctgacaggaagcagaatgaccagaggaaagtgtct
cagggcaggctggctcctcgtcctcctccagttgagaagtccaaagagattgcaatagaa
caaaaggaaaacttcgatcccctccagtaccccgagaccacacccaaaggcctagctcct
gttacaaacagcagtgggaaaatggccctgaacagccctcagcctggccccgtggagagc
gagctggggaagcagctcttgaaaacgggctgggagggcagccctctgccgagaagtcca
acccaggatgcggcaggagtgggtcccccagcctcccaggggagaggcccagctggagag
ccgatggggcccgaggctggctccaaagctgagcttccacccactgtgtcccggcccccg
ctgctgcgagggctctcctgggacagtggccctgaagaacctggcccccggctgcagaaa
gtgcttgccaagctgccactggcagaggaagaaaagcgttttgcaggcaaggccggcggc
aagctggccaaggcccctggtctcaaagactttcagatacaagtgcagcccgtgcggatg
cagaaactgaccaagctccgagaggagcacatcctgatgagaaatcagaacttagtgggg
ctcaagcttccagaccttagtgaagcagctgagcaggaaaaagggcttccttctgaactc
tccccagctattgaggaagaagagtcaaagagtggcttagatgtcatgcctaatatttct
gatgtgctgctgcgcaaactgcgggtccacaggagtctccctggaagtgcccctccactc
actgaaaaggaagttgagaacgtgtttgtgcaactgtccttggcctttagaaatgacagc
tacactctggaatctagaattaaccaggctgaaagggaacgcaacctgacagaggagaac
actgagaaagaactggaaaacttcaaagcttccattacgtcctcagcttcactctggcac
cactgtgagcaccgggaaacctaccagaagttgctggaggacatcgctgtcctgcaccgc
ctggctgcccgcctctccagccgagctgaggtggtaggcgccgtccgccaggaaaagcgc
atgtcgaaagcaacggaagtgatgatgcagtatgtggagaatctaaagaggacgtatgag
aaggaccatgcggagctcatggagtttaaaaagcttgcaaatcagaattcaagccgcagc
tgtggcccctctgaagatggggtccctcgcacggcacggtccatgtccctcacgctggga
aagaatatgcctcgccggagggtcagcgttgctgtggttcctaagtttaatgccctgaat
ctgcctggccaaactcccagctcatcatccattccctccttaccagccttgtcggaatca
cccaatgggaaaggcagcctacctgtcacttcagcactgcctgcacttttggaaaatgga
aagacaaatggggacccagattgtgaagcctctgctcctgcgctgaccctgagctgcctg
gaggagcttagtcaggagaccaaggccaggatggaggaagaagcctacagcaagggattc
caagaaggtctaaagaagaccaaagaacttcaagacctgaaggaggaggaggaagaacag
aagagtgagagtcctgaggaacctgaagaggtagaagaaactgaggaagaggaaaagggc
ccaagaagcagcaaacttgaagaattggtccatttcttacaagtcatgtatcccaaactg
tgtcagcactggcaagtgatctggatgatggctgcagtgatgctggtcttgactgttgtg
ctggggctctacaattcctataactcttgtgcagagcaggctgatgggccccttggaaga
tccacttgctcggcagcccagagggactcctggtggagctcaggactccagcatgagcag
cctacagagcagtag

DBGET integrated database retrieval system