KEGG   Homo sapiens (human): 10342Help
Entry
10342             CDS       T01001                                 

Gene name
TFG, HMSNP, SPG57, TF6, TRKT3
Definition
(RefSeq) TRK-fused gene
  KO
K09292  
protein TFG
Organism
hsa  Homo sapiens (human)
Pathway
Pathways in cancer
Thyroid cancer
Disease
H00014  
Non-small cell lung cancer
H00032  
Thyroid cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    10342 (TFG)
   05216 Thyroid cancer
    10342 (TFG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q92734(Tbio)
UniProt: 
Position
3q12.2
AA seq 400 aa AA seqDB search
MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKD
EDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLL
DSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKN
VMSAFGLTDDQVSGPPSAPAEDRSGTPDSIASSSSAAHPPGVQPQQPPYTGAQTQAGQIE
GQMYQQYQQQAGYGAQQPQAPPQQPQQYGIQYSASYSQQTGPQQPQQFQGYGQQPTSQAP
APAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMAPSQPGAYQPR
PGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPGPGYR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaacggacagttggatctaagtgggaagctaatcatcaaagctcaacttggggaggat
attcggcgaattcctattcataatgaagatattacttatgatgaattagtgctaatgatg
caacgagttttcagaggaaaacttctgagtaatgatgaagtaacaataaagtataaagat
gaagatggagatcttataacaatttttgatagttctgacctttcctttgcaattcagtgc
agtaggatactgaaactgacattatttgttaatggccagccaagaccccttgaatcaagt
caggtgaaatatctccgtcgagaactgatagaacttcgaaataaagtgaatcgtttattg
gatagcttggaaccacctggagaaccaggaccttccaccaatattcctgaaaatgatact
gtggatggtagggaagaaaagtctgcttctgattcttctggaaaacagtctactcaggtt
atggcagcaagtatgtctgcttttgatcctttaaaaaaccaagatgaaatcaataaaaat
gttatgtcagcgtttggcttaacagatgatcaggtttcagggccacccagtgctcctgca
gaagatcgttcaggaacacccgacagcattgcttcctcctcctcagcagctcacccacca
ggcgttcagccacagcagccaccatatacaggagctcagactcaagcaggtcagattgaa
ggtcagatgtaccaacagtaccagcaacaggccggctatggtgcacagcagccgcaggct
ccacctcagcagcctcaacagtatggtattcagtattcagcaagctatagtcagcagact
ggacctcaacaacctcagcagttccagggatatggccagcaaccaacttcccaggcacca
gctcctgccttttctggtcagcctcaacaactgcctgctcagccgccacagcagtaccag
gcgagcaattatcctgcacaaacttacactgcccaaacttctcagcctactaattatact
gtggctcctgcctctcaacctggaatggctccaagccaacctggggcctatcaaccaaga
ccaggttttacttcacttcctggaagtaccatgacccctcctccaagtgggcctaatcct
tatgcgcgtaaccgtcctccctttggtcagggctatacccaacctggacctggttatcga
taa

DBGET integrated database retrieval system