KEGG   Homo sapiens (human): 10344Help
Entry
10344             CDS       T01001                                 

Gene name
CCL26, IMAC, MIP-4a, MIP-4alpha, SCYA26, TSC-1
Definition
chemokine (C-C motif) ligand 26
Orthology
K05514  
C-C motif chemokine, other
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Disease
H01360  
Allergic rhinitis
H01361  
Eosinophilic esophagitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    10344 (CCL26)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    10344 (CCL26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q11.23
AA seq 94 aa AA seqDB search
MMGLSLASAVLLASLLSLHLGTATRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQR
AVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgatgggcctctccttggcctctgctgtgctcctggcctccctcctgagtctccacctt
ggaactgccacacgtgggagtgacatatccaagacctgctgcttccaatacagccacaag
ccccttccctggacctgggtgcgaagctatgaattcaccagtaacagctgctcccagcgg
gctgtgatattcactaccaaaagaggcaagaaagtctgtacccatccaaggaaaaaatgg
gtgcaaaaatacatttctttactgaaaactccgaaacaattgtga

DBGET integrated database retrieval system