KEGG   Homo sapiens (human): 10347Help
Entry
10347             CDS       T01001                                 

Gene name
ABCA7, ABCA-SSN, ABCX
Definition
ATP-binding cassette, sub-family A (ABC1), member 7
Orthology
K05645  
ATP-binding cassette, subfamily A (ABC1), member 7
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    10347 (ABCA7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 2146 aa AA seqDB search
MAFWTQLMLLLWKNFMYRRRQPVQLLVELLWPLFLFFILVAVRHSHPPLEHHECHFPNKP
LPSAGTVPWLQGLICNVNNTCFPQLTPGEEPGRLSNFNDSLVSRLLADARTVLGGASAHR
TLAGLGKLIATLRAARSTAQPQPTKQSPLEPPMLDVAELLTSLLRTESLGLALGQAQEPL
HSLLEAAEDLAQELLALRSLVELRALLQRPRGTSGPLELLSEALCSVRGPSSTVGPSLNW
YEASDLMELVGQEPESALPDSSLSPACSELIGALDSHPLSRLLWRRLKPLILGKLLFAPD
TPFTRKLMAQVNRTFEELTLLRDVREVWEMLGPRIFTFMNDSSNVAMLQRLLQMQDEGRR
QPRPGGRDHMEALRSFLDPGSGGYSWQDAHADVGHLVGTLGRVTECLSLDKLEAAPSEAA
LVSRALQLLAEHRFWAGVVFLGPEDSSDPTEHPTPDLGPGHVRIKIRMDIDVVTRTNKIR
DRFWDPGPAADPLTDLRYVWGGFVYLQDLVERAAVRVLSGANPRAGLYLQQMPYPCYVDD
VFLRVLSRSLPLFLTLAWIYSVTLTVKAVVREKETRLRDTMRAMGLSRAVLWLGWFLSCL
GPFLLSAALLVLVLKLGDILPYSHPGVVFLFLAAFAVATVTQSFLLSAFFSRANLAAACG
GLAYFSLYLPYVLCVAWRDRLPAGGRVAASLLSPVAFGFGCESLALLEEQGEGAQWHNVG
TRPTADVFSLAQVSGLLLLDAALYGLATWYLEAVCPGQYGIPEPWNFPFRRSYWCGPRPP
KSPAPCPTPLDPKVLVEEAPPGLSPGVSVRSLEKRFPGSPQPALRGLSLDFYQGHITAFL
GHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVCPQYNVLFDMLTVDE
HVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQV
VILDEPTAGVDPASRRGIWELLLKYREGRTLILSTHHLDEAELLGDRVAVVAGGRLCCCG
SPLFLRRHLGSGYYLTLVKARLPLTTNEKADTDMEGSVDTRQEKKNGSQGSRVGTPQLLA
LVQHWVPGARLVEELPHELVLVLPYTGAHDGSFATLFRELDTRLAELRLTGYGISDTSLE
EIFLKVVEECAADTDMEDGSCGQHLCTGIAGLDVTLRLKMPPQETALENGEPAGSAPETD
QGSGPDAVGRVQGWALTRQQLQALLLKRFLLARRSRRGLFAQIVLPALFVGLALVFSLIV
PPFGHYPALRLSPTMYGAQVSFFSEDAPGDPGRARLLEALLQEAGLEEPPVQHSSHRFSA
PEVPAEVAKVLASGNWTPESPSPACQCSRPGARRLLPDCPAAAGGPPPPQAVTGSGEVVQ
NLTGRNLSDFLVKTYPRLVRQGLKTKKWVNEVRYGGFSLGGRDPGLPSGQELGRSVEELW
ALLSPLPGGALDRVLKNLTAWAHSLDAQDSLKIWFNNKGWHSMVAFVNRASNAILRAHLP
PGPARHAHSITTLNHPLNLTKEQLSEGALMASSVDVLVSICVVFAMSFVPASFTLVLIEE
RVTRAKHLQLMGGLSPTLYWLGNFLWDMCNYLVPACIVVLIFLAFQQRAYVAPANLPALL
LLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINGSMATFVLELFSDQKLQEV
SRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERLGDRQFQSPLRWEVVGKNLLAMVIQ
GPLFLLFTLLLQHRSQLLPQPRVRSLPLLGEEDEDVARERERVVQGATQGDVLVLRNLTK
VYRGQRMPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAR
EPSAAHLSMGYCPQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYAD
RPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLAVVREGRSVML
TSHSMEECEALCSRLAIMVNGRFRCLGSPQHLKGRFAAGHTLTLRVPAARSQPAAAFVAA
EFPGAELREAHGGRLRFQLPPGGRCALARVFGELAVHGAEHGVEDFSVSQTMLEEVFLYF
SKDQGKDEDTEEQKEAGVGVDPAPGLQHPKRVSQFLDDPSTAETVL
NT seq 6441 nt NT seq  +upstreamnt  +downstreamnt
atggccttctggacacagctgatgctgctgctctggaagaatttcatgtatcgccggaga
cagccggtccagctcctggtcgaattgctgtggcctctcttcctcttcttcatcctggtg
gctgttcgccactcccacccgcccctggagcaccatgaatgccacttcccaaacaagcca
ctgccatcggcgggcaccgtgccctggctccagggtctcatctgtaatgtgaacaacacc
tgctttccgcagctgacaccgggcgaggagcccgggcgcctgagcaacttcaacgactcc
ctggtctcccggctgctagccgatgcccgcactgtgctgggaggggccagtgcccacagg
acgctggctggcctagggaagctgatcgccacgctgagggctgcacgcagcacggcccag
cctcaaccaaccaagcagtctccactggaaccacccatgctggatgtcgcggagctgctg
acgtcactgctgcgcacggaatccctggggttggcactgggccaagcccaggagcccttg
cacagcttgttggaggccgctgaggacctggcccaggagctcctggcgctgcgcagcctg
gtggagcttcgggcactgctgcagagaccccgagggaccagcggccccctggagttgctg
tcagaggccctctgcagtgtcaggggacctagcagcacagtgggcccctccctcaactgg
tacgaggctagtgacctgatggagctggtggggcaggagccagaatccgccctgccagac
agcagcctgagccccgcctgctcggagctgattggagccctggacagccacccgctgtcc
cgcctgctctggagacgcctgaagcctctgatcctcgggaagctactctttgcaccagat
acaccttttacccggaagctcatggcccaggtgaaccggaccttcgaggagctcaccctg
ctgagggatgtccgggaggtgtgggagatgctgggaccccggatcttcaccttcatgaac
gacagttccaatgtggccatgctgcagcggctcctgcagatgcaggatgaaggaagaagg
cagcccagacctggaggccgggaccacatggaggccctgcgatcctttctggaccctggg
agcggtggctacagctggcaggacgcacacgctgatgtggggcacctggtgggcacgctg
ggccgagtgacggagtgcctgtccttggacaagctggaggcggcaccctcagaggcagcc
ctggtgtcgcgggccctgcaactgctcgcggaacatcgattctgggccggcgtcgtcttc
ttgggacctgaggactcttcagaccccacagagcacccaaccccagacctgggccccggc
cacgtgcgcatcaaaatccgcatggacattgacgtggtcacgaggaccaataagatcagg
gacaggttttgggaccctggcccagccgcggaccccctgaccgacctgcgctacgtgtgg
ggcggcttcgtgtacctgcaagacctggtggagcgtgcagccgtccgcgtgctcagcggc
gccaacccccgggccggcctctacctgcagcagatgccctatccgtgctatgtggacgac
gtgttcctgcgtgtgctgagccggtcgctgccgctcttcctgacgctggcctggatctac
tccgtgacactgacagtgaaggccgtggtgcgggagaaggagacgcggctgcgggacacc
atgcgcgccatggggctcagccgcgcggtgctctggctaggctggttcctcagctgcctc
gggcccttcctgctcagcgccgcactgctggttctggtgctcaagctgggagacatcctc
ccctacagccacccgggcgtggtcttcctgttcttggcagccttcgcggtggccacggtg
acccagagcttcctgctcagcgccttcttctcccgcgccaacctggctgcggcctgcggc
ggcctggcctacttctccctctacctgccctacgtgctgtgtgtggcttggcgggaccgg
ctgcccgcgggtggccgcgtggccgcgagcctgctgtcgcccgtggccttcggcttcggc
tgcgagagcctggctctgctggaggagcagggcgagggcgcgcagtggcacaacgtgggc
acccggcctacggcagacgtcttcagcctggcccaggtctctggccttctgctgctggac
gcggcgctctacggcctcgccacctggtacctggaagctgtgtgcccaggccagtacggg
atccctgaaccatggaattttccttttcggaggagctactggtgcggacctcggcccccc
aagagtccagccccttgccccaccccgctggacccaaaggtgctggtagaagaggcaccg
cccggcctgagtcctggcgtctccgttcgcagcctggagaagcgctttcctggaagcccg
cagccagccctgcgggggctcagcctggacttctaccagggccacatcaccgccttcctg
ggccacaacggggccggcaagaccaccaccctgtccatcttgagtggcctcttcccaccc
agtggtggctctgccttcatcctgggccacgacgtccgctccagcatggccgccatccgg
ccccacctgggcgtctgtcctcagtacaacgtgctgtttgacatgctgaccgtggacgag
cacgtctggttctatgggcggctgaagggtctgagtgccgctgtagtgggccccgagcag
gaccgtctgctgcaggatgtggggctggtctccaagcagagtgtgcagactcgccacctc
tctggtgggatgcaacggaagctgtccgtggccattgcctttgtgggcggctcccaagtt
gttatcctggacgagcctacggctggcgtggatcctgcttcccgccgcggtatttgggag
ctgctgctcaaataccgagaaggtcgcacgctgatcctctccacccaccacctggatgag
gcagagctgctgggagaccgtgtggccgtggtggcaggtggccgcttgtgctgctgtggc
tccccactcttcctgcgccgtcacctgggctccggctactacctgacgctggtgaaggcc
cgcctgcccctgaccaccaatgagaaggctgacactgacatggagggcagtgtggacacc
aggcaggaaaagaagaatggcagccagggcagcagagtcggcactcctcagctgctggcc
ctggtacagcactgggtgcccggggcacggctggtggaggagctgccacacgagctggtg
ctggtgctgccctacacgggtgcccatgacggcagcttcgccacactcttccgagagcta
gacacgcggctggcggagctgaggctcactggctacgggatctccgacaccagcctcgag
gagatcttcctgaaggtggtggaggagtgtgctgcggacacagatatggaggatggcagc
tgcgggcagcacctatgcacaggcattgctggcctagacgtaaccctacggctcaagatg
ccgccacaggagacagcgctggagaacggggaaccagctgggtcagccccagagactgac
cagggctctgggccagacgccgtgggccgggtacagggctgggcactgacccgccagcag
ctccaggccctgcttctcaagcgctttctgcttgcccgccgcagccgccgcggcctgttc
gcccagatcgtgctgcctgccctctttgtgggcctggccctcgtgttcagcctcatcgtg
cctcctttcgggcactacccggctctgcggctcagtcccaccatgtacggtgctcaggtg
tccttcttcagtgaggacgccccaggggaccctggacgtgcccggctgctcgaggcgctg
ctgcaggaggcaggactggaggagcccccagtgcagcatagctcccacaggttctcggca
ccagaagttcctgctgaagtggccaaggtcttggccagtggcaactggaccccagagtct
ccatccccagcctgccagtgtagccggcccggtgcccggcgcctgctgcccgactgcccg
gctgcagctggtggtccccctccgccccaggcagtgaccggctctggggaagtggttcag
aacctgacaggccggaacctgtctgacttcctggtcaagacctacccgcgcctggtgcgc
cagggcctgaagactaagaagtgggtgaatgaggtcagatacggaggcttctcgctgggg
ggccgagacccaggcctgccctcgggccaagagttgggccgctcagtggaggagttgtgg
gcgctgctgagtcccctgcctggcggggccctcgaccgtgtcctgaaaaacctcacagcc
tgggctcacagcctggatgctcaggacagtctcaagatctggttcaacaacaaaggctgg
cactccatggtggcctttgtcaaccgagccagcaacgcaatcctccgtgctcacctgccc
ccaggcccggcccgccacgcccacagcatcaccacactcaaccaccccttgaacctcacc
aaggagcagctgtctgagggtgcactgatggcctcctcggtggacgtcctcgtctccatc
tgtgtggtctttgccatgtcctttgtcccggccagcttcactcttgtcctcattgaggag
cgagtcacccgagccaagcacctgcagctcatggggggcctgtcccccaccctctactgg
cttggcaactttctctgggacatgtgtaactacttggtgccagcatgcatcgtggtgctc
atctttctggccttccagcagagggcatatgtggcccctgccaacctgcctgctctcctg
ctgttgctactactgtatggctggtcgatcacaccgctcatgtacccagcctccttcttc
ttctccgtgcccagcacagcctatgtggtgctcacctgcataaacctctttattggcatc
aatggaagcatggccacctttgtgcttgagctcttctctgatcagaagctgcaggaggtg
agccggatcttgaaacaggtcttccttatcttcccccacttctgcttgggccgggggctc
attgacatggtgcggaaccaggccatggctgatgcctttgagcgcttgggagacaggcag
ttccagtcacccctgcgctgggaggtggtcggcaagaacctcttggccatggtgatacag
gggcccctcttccttctcttcacactactgctgcagcaccgaagccaactcctgccacag
cccagggtgaggtctctgccactcctgggagaggaggacgaggatgtagcccgtgaacgg
gagcgggtggtccaaggagccacccagggggatgtgttggtgctgaggaacttgaccaag
gtataccgtgggcagaggatgccagctgttgaccgcttgtgcctggggattccccctggt
gagtgttttgggctgctgggtgtgaatggagcagggaagacgtccacgtttcgcatggtg
acgggggacacattggccagcaggggcgaggctgtgctggcaggccacagcgtggcccgg
gaacccagtgctgcgcacctcagcatgggatactgccctcaatccgatgccatctttgag
ctgctgacgggccgcgagcacctggagctgcttgcgcgcctgcgcggtgtcccggaggcc
caggttgcccagaccgctggctcgggcctggcgcgtctgggactctcatggtacgcagac
cggcctgcaggcacctacagcggagggaacaaacgcaagctggcgacggccctggcgctg
gttggggacccagccgtggtgtttctggacgagccgaccacaggcatggaccccagcgcg
cggcgcttcctttggaacagccttttggccgtggtgcgggagggccgttcagtgatgctc
acctcccatagcatggaggagtgtgaagcgctctgctcgcgcctggccatcatggtgaat
gggcggttccgctgcctgggcagcccgcaacatctcaagggcagattcgcggcgggtcac
acactgaccctgcgggtgcccgccgcaaggtcccagccggcagcggccttcgtggcggcc
gagttccctggggcggagctgcgcgaggcacatggaggccgcctgcgcttccagctgccg
ccgggagggcgctgcgccctggcgcgcgtctttggagagctggcggtgcacggcgcagag
cacggcgtggaggacttttccgtgagccagacgatgctggaggaggtattcttgtacttc
tccaaggaccaggggaaggacgaggacaccgaagagcagaaggaggcaggagtgggagtg
gaccccgcgccaggcctgcagcaccccaaacgcgtcagccagttcctcgatgaccctagc
actgccgagactgtgctctga

DBGET integrated database retrieval system