KEGG   Homo sapiens (human): 10349Help
Entry
10349             CDS       T01001                                 

Gene name
ABCA10, EST698739
Definition
ATP-binding cassette, sub-family A (ABC1), member 10
Orthology
K05652  
ATP-binding cassette, subfamily A (ABC1), member 10
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    10349 (ABCA10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q24
AA seq 1543 aa AA seqDB search
MNKMALASFMKGRTVIGTPDEETMDIELPKKYHEMVGVIFSDTFSYRLKFNWGYRIPVIK
EHSEYTEHCWAMHGEIFCYLAKYWLKGFVAFQAAINAAIIEVTTNHSVMEELTSVIGINM
KIPPFISKGEIMNEWFHFTCLVSFSSFIYFASLNVARERGKFKKLMTVMGLRESAFWLSW
GLTYICFIFIMSIFMALVITSIPIVFHTGFMVIFTLYSLYGLSLIALAFLMSVLIRKPML
AGLAGFLFTVFWGCLGFTVLYRQLPLSLGWVLSLLSPFAFTAGMAQITHLDNYLSGVIFP
DPSGDSYKMIATFFILAFDTLFYLIFTLYFERVLPDKDGHGDSPLFFLKSSFWSKHQNTH
HEIFENEINPEHSSDDSFEPVSPEFHGKEAIRIRNVIKEYNGKTGKVEALQGIFFDIYEG
QITAILGHNGAGKSTLLNILSGLSVSTEGSATIYNTQLSEITDMEEIRKNIGFCPQFNFQ
FDFLTVRENLRVFAKIKGIQPKEVEQEVKRIIMELDMQSIQDIIAKKLSGGQKRKLTLGI
AILGDPQVLLLDEPTAGLDPFSRHRVWSLLKEHKVDRLILFSTQFMDEADILADRKVFLS
NGKLKCAGSSLFLKRKWGIGYHLSLHRNEMCDTEKITSLIKQHIPDAKLTTESEEKLVYS
LPLEKTNKFPDLYSDLDKCSDQGIRNYAVSVTSLNEVFLNLEGKSAIDEPDFDIGKQEKI
HVTRNTGDESEMEQVLCSLPETRKAVSSAALWRRQIYAVATLRFLKLRRERRALLCLLLV
LGIAFIPIILEKIMYKVTRETHCWEFSPSMYFLSLEQIPKTPLTSLLIVNNTGSNIEDLV
HSLKCQDIVLEIDDFRNRNGSDDPSYNGAIIVSGDQKDYRFSVACNTKKLNCFPVLMGIV
SNALMGIFNFTELIQMESTSFSRDDIVLDLGFIDGSIFLLLITNCVSPFIGMSSISDYKK
NVQSQLWISGLWPSAYWCGQALVDIPLYFLILFSIHLIYYFIFLGFQLSWELMFVLVVCI
IGCAVSLIFLTYVLSFIFRKWRKNNGFWSFGFFIILICVSTIMVSTQYEKLNLILCMIFI
PSFTLLGYVMLLIQLDFMRNLDSLDNRINEVNKTILLTTLIPYLQSVIFLFVIRCLEMKY
GNEIMNKDPVFRISPRSRETHPNPEEPEEEDEDVQAERVQAANALTAPNLEEEPVITASC
LHKEYYETKKSCFSTRKKKIAIRNVSFCVKKGEVLGLLGHNGAGKSTSIKMITGCTKPTA
GVVVLQGSRASVRQQHDNSLKFLGYCPQENSLWPKLTMKEHLELYAAVKGLGKEDAALSI
SRLVEALKLQEQLKAPVKTLSEGIKRKLCFVLSILGNPSVVLLDEPFTGMDPEGQQQMWQ
ILQATVKNKERGTLLTTHYMSEAEAVCDRMAMMVSGTLRCIGSIQHLKNKFGRDYLLEIK
MKEPTQVEALHTEILKLFPQAAWQERYSSLMAYKLPVEDVHPLSRAFFKLEAMKQTFNLE
EYSLSQATLEQVFLELCKEQELGNVDDKIDTTVEWKLLPQEDP
NT seq 4632 nt NT seq  +upstreamnt  +downstreamnt
atgaataagatggccttggcttcctttatgaaaggaagaacagtcattgggacaccagat
gaagagaccatggatatagaacttccaaaaaaataccatgaaatggtgggagttatattt
agtgatactttctcatatcgcctgaagtttaattggggatatagaatcccagttataaag
gagcactctgaatacacagaacactgttgggccatgcatggtgaaattttttgttacttg
gcaaagtactggctaaaagggtttgtagcttttcaagctgcaattaatgctgcaattata
gaagtcacaacaaatcattctgtaatggaggagttgacatcagttattggaataaatatg
aagataccacctttcatttctaagggagaaattatgaatgaatggtttcattttacttgc
ttagtttctttctcttcttttatatactttgcatcattaaatgttgcaagggaaagagga
aaatttaagaaactgatgacagtgatgggtctccgagagtcagcattctggctctcctgg
ggattgacatacatttgcttcatcttcattatgtccatttttatggctctggtcataaca
tcaatcccaattgtatttcatactggcttcatggtgatattcacactctatagcttatat
ggcctttctttgatagcattggctttcctcatgagtgttttaataaggaaacctatgctc
gctggtttggctggatttctcttcactgtattttggggatgtctgggattcactgtgtta
tatagacaacttcctttatctttgggatgggtattaagtcttcttagcccttttgccttc
actgctggaatggcccagattacacacctggataattacttaagtggtgttatttttcct
gatccctctggggattcatacaaaatgatagccacttttttcattttggcatttgatact
cttttctatttgatattcacattatattttgagcgagttttacctgataaagatggccat
ggggattctccattatttttccttaagtcctcattttggtccaaacatcaaaatactcat
catgaaatctttgagaatgaaataaatcctgagcattcctctgatgattcttttgaaccg
gtgtctccagaattccatggaaaagaagccataagaatcagaaatgttataaaagaatat
aatggaaagactggaaaagtagaagcattgcaaggcatattttttgacatatatgaagga
cagatcactgcaatacttgggcataatggagctggtaaatcaacactgctaaacattctt
agtggattgtctgtttctacagaaggatcagccactatttataatactcaactctctgaa
ataactgacatggaagaaattagaaagaatattggattttgtccacagttcaattttcaa
tttgacttcctcactgtgagagaaaacctcagggtatttgctaaaataaaagggattcag
ccaaaggaagtggaacaagaggtaaaaagaattataatggaattagacatgcaaagcatt
caagacattattgctaaaaaattaagtggtgggcagaagagaaaactaacactagggatt
gccatcttaggagatcctcaggttttgctgctagatgaaccaactgctggattggatccc
ttttcaagacaccgagtgtggagcctcctgaaggagcataaagtagaccgacttatcctc
ttcagtacccaattcatggatgaggctgacatcttggctgataggaaagtatttctgtct
aatgggaagttgaaatgtgcaggatcatctttgtttctgaagcgaaagtggggtattgga
tatcatttaagtttacacaggaatgaaatgtgtgacacagaaaaaatcacatcccttatt
aagcagcacattcctgatgccaagttaacaacagaaagtgaagaaaaacttgtatatagt
ttgcctttggaaaaaacgaacaaatttccagatctttacagtgaccttgataagtgttct
gaccagggcataaggaattatgctgtttcagtgacatctctgaatgaagtattcttgaac
ctagaaggaaaatcagcaattgatgaaccagattttgacattgggaaacaagagaaaata
catgtgacaagaaatactggagatgagtctgaaatggaacaggttctttgttctcttcct
gaaacaagaaaggctgtcagtagtgcagctctctggagacgacaaatctatgcagtggca
acacttcgcttcttaaagttaaggcgtgaaaggagagctcttttgtgtttgttactagta
cttggaattgcttttatccccatcattctagagaagataatgtataaagtaactcgtgaa
actcattgttgggagttttcacccagtatgtatttcctttctctggaacaaatcccgaag
acgcctcttaccagcctgttaatcgttaataatacaggatcaaatattgaagacctcgtg
cattcactgaagtgtcaggatatagttttggaaatagatgactttagaaacagaaatggc
tcagatgatccctcctacaatggagccatcatagtgtctggtgaccagaaggattacaga
ttttctgttgcgtgtaataccaagaaattgaattgttttcctgttcttatgggaattgtt
agcaatgcccttatgggaatttttaacttcacggagcttattcaaatggagagcacttca
ttttctcgtgatgacatagtgctggatcttggttttatagatgggtccatatttttgttg
ttgatcacaaactgcgtttctccttttatcggcatgagcagcatcagcgattataaaaaa
aatgttcaatcccagttatggatttcaggcctctggccttcagcatactggtgtggacag
gctctggtggacattccattatacttcttgattctcttttcaatacatttaatttactac
ttcatatttctgggattccagctttcatgggaactcatgtttgttttggtggtatgcata
attggttgtgcagtttctcttatattcctcacatatgtgctttcattcatctttcgcaag
tggagaaaaaataatggcttttggtcttttggcttttttattatcttaatatgtgtatcc
acaattatggtatcaactcaatatgaaaaactcaacttaattttgtgcatgattttcata
ccttccttcactttgctggggtatgtcatgttattgatccagctcgactttatgagaaac
ttggacagtctggacaatagaataaatgaagtcaataaaaccattcttttaacaacctta
ataccataccttcagagtgttattttcctttttgtcataaggtgtctggaaatgaagtat
ggaaatgaaataatgaataaagacccagttttcagaatctctccacggagtagagaaact
catcccaatccggaagagcccgaagaagaagatgaagatgttcaagctgaaagagtccaa
gcagcaaatgcactcactgctccaaacttggaggaggaaccagtcataactgcaagctgt
ttacacaaggaatattatgagacaaagaaaagttgcttttcaacaagaaagaagaaaata
gccatcagaaatgtttccttttgtgttaaaaaaggtgaagttttgggattactaggacac
aatggagctggtaaaagtacttccattaaaatgataactgggtgcacaaagccaactgca
ggagtggtggtgttacaaggcagcagagcatcagtaaggcaacagcatgacaacagcctc
aagttcttggggtactgccctcaggagaactcactgtggcccaagcttacaatgaaagag
cacttggagttgtatgcagctgtgaaaggactgggcaaagaagatgctgctctcagtatt
tcacgattggtggaagctcttaagctccaggaacaacttaaggctcctgtgaaaactcta
tcagagggaataaagagaaagctgtgctttgtgctgagcatcctggggaacccatcagtg
gtgcttctagatgagccgttcaccgggatggaccccgaggggcagcagcaaatgtggcag
atacttcaggctaccgttaaaaacaaggagaggggcaccctcttgaccacccattacatg
tcagaggctgaggctgtgtgtgaccgtatggccatgatggtgtcaggaacgctaaggtgt
attggttccattcaacatctgaaaaacaagtttggtagagattatttactagaaataaaa
atgaaagaacctacccaggtggaagctctccacacagagattttgaagcttttcccacag
gctgcttggcaggaaagatattcctctttaatggcgtataagttacctgtggaggatgtc
caccctctatctcgggcctttttcaagttagaggcgatgaaacagaccttcaacctggag
gaatacagcctctctcaggctaccttggagcaggtattcttagaactctgtaaagagcag
gagctgggaaatgttgatgataaaattgatacaacagttgaatggaaacttctcccacag
gaagacccttaa

DBGET integrated database retrieval system