KEGG   Homo sapiens (human): 10350Help
Entry
10350             CDS       T01001                                 

Gene name
ABCA9, EST640918
Definition
(RefSeq) ATP binding cassette subfamily A member 9
  KO
K05651  ATP-binding cassette, subfamily A (ABC1), member 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    10350 (ABCA9)
Transporters [BR:hsa02000]
 ABC Transporters, Eukaryotic Type
  ABCA (ABC1) subfamily
   ABCA5, 6, 8, 9, 10 subgroups
    10350 (ABCA9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_tran ABC2_membrane_3 AAA_21 RsgA_GTPase AAA_29 MMR_HSR1 AAA_23 AAA_16
Motif
Other DBs
NCBI-GeneID: 10350
NCBI-ProteinID: NP_525022
OMIM: 612507
HGNC: 39
Ensembl: ENSG00000154258
Vega: OTTHUMG00000140371
Pharos: Q8IUA7(Tdark)
UniProt: Q8IUA7
Position
17q24.2
AA seq 1624 aa AA seqDB search
MSKRRMSVGQQTWALLCKNCLKKWRMKRQTLLEWLFSFLLVLFLYLFFSNLHQVHDTPQM
SSMDLGRVDSFNDTNYVIAFAPESKTTQEIMNKVASAPFLKGRTIMGWPDEKSMDELDLN
YSIDAVRVIFTDTFSYHLKFSWGHRIPMMKEHRDHSAHCQAVNEKMKCEGSEFWEKGFVA
FQAAINAAIIEIATNHSVMEQLMSVTGVHMKILPFVAQGGVATDFFIFFCIISFSTFIYY
VSVNVTQERQYITSLMTMMGLRESAFWLSWGLMYAGFILIMATLMALIVKSAQIVVLTGF
VMVFTLFLLYGLSLITLAFLMSVLIKKPFLTGLVVFLLIVFWGILGFPALYTRLPAFLEW
TLCLLSPFAFTVGMAQLIHLDYDVNSNAHLDSSQNPYLIIATLFMLVFDTLLYLVLTLYF
DKILPAEYGHRCSPLFFLKSCFWFQHGRANHVVLENETDSDPTPNDCFEPVSPEFCGKEA
IRIKNLKKEYAGKCERVEALKGVVFDIYEGQITALLGHSGAGKTTLLNILSGLSVPTSGS
VTVYNHTLSRMADIENISKFTGFCPQSNVQFGFLTVKENLRLFAKIKGILPHEVEKEVQR
VVQELEMENIQDILAQNLSGGQNRKLTFGIAILGDPQVLLLDEPTAGLDPLSRHRIWNLL
KEGKSDRVILFSTQFIDEADILADRKVFISNGKLKCAGSSLFLKKKWGIGYHLSLHLNER
CDPESITSLVKQHISDAKLTAQSEEKLVYILPLERTNKFPELYRDLDRCSNQGIEDYGVS
ITTLNEVFLKLEGKSTIDESDIGIWGQLQTDGAKDIGSLVELEQVLSSFHETRKTISGVA
LWRQQVCAIAKVRFLKLKKERKSLWTILLLFGISFIPQLLEHLFYESYQKSYPWELSPNT
YFLSPGQQPQDPLTHLLVINKTGSTIDNFLHSLRRQNIAIEVDAFGTRNGTDDPSYNGAI
IVSGDEKDHRFSIACNTKRLNCFPVLLDVISNGLLGIFNSSEHIQTDRSTFFEEHMDYEY
GYRSNTFFWIPMAASFTPYIAMSSIGDYKKKAHSQLRISGLYPSAYWFGQALVDVSLYFL
ILLLMQIMDYIFSPEEIIFIIQNLLIQILCSIGYVSSLVFLTYVISFIFRNGRKNSGIWS
FFFLIVVIFSIVATDLNEYGFLGLFFGTMLIPPFTLIGSLFIFSEISPDSMDYLGASESE
IVYLALLIPYLHFLIFLFILRCLEMNCRKKLMRKDPVFRISPRSNAIFPNPEEPEGEEED
IQMERMRTVNAMAVRDFDETPVIIASCLRKEYAGKKKNCFSKRKKKIATRNVSFCVKKGE
VIGLLGHNGAGKSTTIKMITGDTKPTAGQVILKGSGGGEPLGFLGYCPQENALWPNLTVR
QHLEVYAAVKGLRKGDAMIAITRLVDALKLQDQLKAPVKTLSEGIKRKLCFVLSILGNPS
VVLLDEPSTGMDPEGQQQMWQVIRATFRNTERGALLTTHYMAEAEAVCDRVAIMVSGRLR
CIGSIQHLKSKFGKDYLLEMKLKNLAQMEPLHAEILRLFPQAAQQERFSSLMVYKLPVED
VRPLSQAFFKLEIVKQSFDLEEYSLSQSTLEQVFLELSKEQELGDLEEDFDPSVKWKLLL
QEEP
NT seq 4875 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagagacgcatgagcgtgggtcagcaaacatgggctcttctctgcaagaactgt
ctcaaaaaatggagaatgaaaagacagaccttgttggaatggctcttttcatttcttctg
gtactgtttctgtacctatttttctccaatttacatcaagttcatgacactcctcaaatg
tcttcaatggatctgggacgtgtagatagttttaatgatactaattatgttattgcattt
gcacctgaatccaaaactacccaagagataatgaacaaagtggcttcagccccattccta
aaaggaagaacaatcatggggtggcctgatgaaaaaagcatggatgaattggatttgaac
tattcaatagacgcagtgagagtcatctttactgataccttctcctaccatttgaagttt
tcttggggacatagaatccccatgatgaaagagcacagagaccattcagctcactgtcaa
gcagtgaatgaaaaaatgaagtgtgaaggttcagagttctgggagaaaggctttgtagct
tttcaagctgccattaatgctgctatcatagaaatcgcaacaaatcattcagtgatggaa
cagctgatgtcagttactggtgtacatatgaagatattaccttttgttgcccaaggagga
gttgcaactgattttttcattttcttttgcattatttctttttctacatttatatactat
gtatcagtcaatgttacacaagaaagacaatacattacgtcattgatgacaatgatggga
ctccgagagtcagcattctggctttcctggggtttgatgtatgctggcttcatccttatc
atggccactttaatggctcttattgtaaaatctgcacaaattgtcgtcctgactggtttt
gtgatggtcttcaccctctttctcctctatggcctgtctttgataactttagctttcctg
atgagtgtgttgataaagaaacctttccttacgggcttggttgtgtttctccttattgtc
ttttgggggatcctgggattcccagcattgtatacacgtcttcctgcatttttggaatgg
actttgtgtcttcttagcccctttgccttcactgttgggatggcccagcttatacatttg
gactatgatgtgaattctaatgcccacttggattcttcacaaaatccatacctcataata
gctactcttttcatgttggtttttgacacccttctgtatttggtattgacattatatttt
gacaaaattttgcccgctgaatatggacatcgatgttctcccttgtttttcctgaaatcc
tgtttttggtttcaacacggaagggctaatcatgtggtccttgagaatgaaacagattct
gatcctacacctaatgactgttttgaaccagtgtctccagaattctgtgggaaagaagcc
atcagaatcaaaaatcttaaaaaagaatatgcagggaagtgtgagagagtagaagctttg
aaaggtgtggtgtttgacatatatgaaggccagatcactgccctccttggtcacagtgga
gctggaaaaactaccctgttaaacatacttagtgggttgtcagttccaacatcaggttca
gtcactgtctataatcacacactttcaagaatggctgatatagaaaatatcagcaagttc
actggattttgtccacaatccaatgtgcaatttggatttctcactgtgaaagaaaacctc
aggctgtttgctaaaataaaagggattttgccacatgaagtggagaaagaggtacaacga
gttgtacaggaattagaaatggaaaatattcaagacatccttgctcaaaacttaagtggt
ggacaaaataggaaactaacttttgggattgccattttaggagatcctcaagttttgcta
ttggatgaaccgactgctggattggatcctctttcaaggcaccgaatatggaatctcctg
aaagaggggaaatcagacagagtaattctcttcagcacccagtttatagatgaggctgac
attctggcggacaggaaggtgttcatatccaatgggaagctgaagtgtgcaggctcttct
ctgttccttaagaagaaatggggcataggctaccatttaagtttgcatctgaatgaaagg
tgtgatccagagagtataacatcactggttaagcagcacatctctgatgccaaattgaca
gcacaaagtgaagaaaaacttgtatatattttgcctttggaaaggacaaacaaatttcca
gaactttacagggatcttgatagatgttctaaccaaggcattgaggattatggtgtttcc
ataacaactttgaatgaggtgtttctgaaattagaaggaaaatcaactattgatgaatca
gatattggaatttggggacaattacaaactgatggggcaaaagatataggaagccttgtt
gagctggaacaagttttgtcttccttccacgaaacaaggaaaacaatcagtggcgtggcg
ctctggaggcagcaggtctgtgcaatagcaaaagttcgcttcctaaagttaaagaaagaa
agaaaaagcctgtggactatattattgctttttggtattagctttatccctcaacttttg
gaacatctattctacgagtcatatcagaaaagttacccgtgggaactgtctccaaataca
tacttcctctcaccaggacaacaaccacaggatcctctgacccatttactggtcatcaat
aagacagggtcaaccattgataactttttacattcactgaggcgacagaacatagctata
gaagtggatgcctttggaactagaaatggcacagatgacccatcttacaatggtgctatc
attgtgtcaggtgatgaaaaggatcacagattttcaatagcatgtaatacaaaacggctg
aattgctttcctgtcctcctggatgtcattagcaatggactacttggaatttttaattcg
tcagaacacattcagactgacagaagcacattttttgaagagcatatggattatgagtat
gggtaccgaagtaacaccttcttctggataccgatggcagcctctttcactccatacatt
gcaatgagcagcattggtgactacaaaaaaaaagctcattcccagctacggatttcaggc
ctctacccttctgcatactggtttggccaagcactggtggatgtttccctgtactttttg
atcctcctgctaatgcaaataatggattatatttttagcccagaggagattatatttata
attcaaaacctgttaattcaaatcctgtgtagtattggctatgtctcatctcttgttttc
ttgacatatgtgatttcattcatttttcgcaatgggagaaaaaatagtggcatttggtca
tttttcttcttaattgtggtcatcttctcgatagttgctactgatctaaatgaatatgga
tttctagggctattttttggcaccatgttaatacctcccttcacattgattggctctcta
ttcattttttctgagatttctcctgattccatggattacttaggagcttcagaatctgaa
attgtatacctggcactgctaataccttaccttcattttctcatttttcttttcattctg
cgatgcctagaaatgaactgcaggaagaaactaatgagaaaggatcctgtgttcagaatt
tctccaagaagcaacgctatttttccaaacccagaagagcctgaaggagaggaggaagat
atccagatggaaagaatgagaacagtgaatgctatggctgtgcgagactttgatgagaca
cccgtcatcattgccagctgtctacggaaggaatatgcaggcaaaaagaaaaattgcttt
tctaaaaggaagaaaaaaattgccacaagaaatgtctctttttgtgttaaaaaaggtgaa
gttataggactgttaggacacaatggagctggtaaaagtacaactattaagatgataact
ggagacacaaaaccaactgcaggacaggtgattttgaaagggagcggtggaggggaaccc
ctgggcttcctggggtactgccctcaggagaatgcgctgtggcccaacctgacagtgagg
cagcacctggaggtgtacgctgccgtgaaaggtctcaggaaaggggacgcaatgatcgcc
atcacacggttagtggatgcgctcaagctgcaggaccagctgaaggctcccgtgaagacc
ttgtcagagggaataaagcgaaagctgtgctttgtgctgagcatcctggggaacccgtca
gtggtgcttctggatgagccgtcgaccgggatggaccccgaggggcagcagcaaatgtgg
caggtgattcgggccacctttagaaacacggagaggggcgccctcctgaccacccactac
atggcagaggctgaggcggtgtgtgaccgagtggccatcatggtgtcaggaaggctgaga
tgtattggttccatccaacacctgaaaagcaaatttggcaaagactacctgctggagatg
aagctgaagaacctggcacaaatggagcccctccatgcagagatcctgaggcttttcccc
caggctgctcagcaggaaaggttctcctccctgatggtctataagttgcctgttgaggat
gtgcgacctttatcacaggctttcttcaaattagagatagttaaacagagtttcgacctg
gaggagtacagcctctcacagtctaccctggagcaggttttcctggagctctccaaggag
caggagctgggtgatcttgaagaggactttgatccctcggtgaagtggaaactcctcctg
caggaagagccttaa

DBGET integrated database retrieval system