KEGG   Homo sapiens (human): 10350Help
Entry
10350             CDS       T01001                                 

Gene name
ABCA9, EST640918
Definition
ATP-binding cassette, sub-family A (ABC1), member 9
Orthology
K05651  
ATP-binding cassette, subfamily A (ABC1), member 9
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    10350 (ABCA9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q24.2
AA seq 1624 aa AA seqDB search
MSKRRMSVGQQTWALLCKNCLKKWRMKRQTLLEWLFSFLLVLFLYLFFSNLHQVHDTPQM
SSMDLGRVDSFNDTNYVIAFAPESKTTQEIMNKVASAPFLKGRTIMGWPDEKSMDELDLN
YSIDAVRVIFTDTFSYHLKFSWGHRIPMMKEHRDHSAHCQAVNEKMKCEGSEFWEKGFVA
FQAAINAAIIEIATNHSVMEQLMSVTGVHMKILPFVAQGGVATDFFIFFCIISFSTFIYY
VSVNVTQERQYITSLMTMMGLRESAFWLSWGLMYAGFILIMATLMALIVKSAQIVVLTGF
VMVFTLFLLYGLSLITLAFLMSVLIKKPFLTGLVVFLLIVFWGILGFPALYTRLPAFLEW
TLCLLSPFAFTVGMAQLIHLDYDVNSNAHLDSSQNPYLIIATLFMLVFDTLLYLVLTLYF
DKILPAEYGHRCSPLFFLKSCFWFQHGRANHVVLENETDSDPTPNDCFEPVSPEFCGKEA
IRIKNLKKEYAGKCERVEALKGVVFDIYEGQITALLGHSGAGKTTLLNILSGLSVPTSGS
VTVYNHTLSRMADIENISKFTGFCPQSNVQFGFLTVKENLRLFAKIKGILPHEVEKEVQR
VVQELEMENIQDILAQNLSGGQNRKLTFGIAILGDPQVLLLDEPTAGLDPLSRHRIWNLL
KEGKSDRVILFSTQFIDEADILADRKVFISNGKLKCAGSSLFLKKKWGIGYHLSLHLNER
CDPESITSLVKQHISDAKLTAQSEEKLVYILPLERTNKFPELYRDLDRCSNQGIEDYGVS
ITTLNEVFLKLEGKSTIDESDIGIWGQLQTDGAKDIGSLVELEQVLSSFHETRKTISGVA
LWRQQVCAIAKVRFLKLKKERKSLWTILLLFGISFIPQLLEHLFYESYQKSYPWELSPNT
YFLSPGQQPQDPLTHLLVINKTGSTIDNFLHSLRRQNIAIEVDAFGTRNGTDDPSYNGAI
IVSGDEKDHRFSIACNTKRLNCFPVLLDVISNGLLGIFNSSEHIQTDRSTFFEEHMDYEY
GYRSNTFFWIPMAASFTPYIAMSSIGDYKKKAHSQLRISGLYPSAYWFGQALVDVSLYFL
ILLLMQIMDYIFSPEEIIFIIQNLLIQILCSIGYVSSLVFLTYVISFIFRNGRKNSGIWS
FFFLIVVIFSIVATDLNEYGFLGLFFGTMLIPPFTLIGSLFIFSEISPDSMDYLGASESE
IVYLALLIPYLHFLIFLFILRCLEMNCRKKLMRKDPVFRISPRSNAIFPNPEEPEGEEED
IQMERMRTVNAMAVRDFDETPVIIASCLRKEYAGKKKNCFSKRKKKIATRNVSFCVKKGE
VIGLLGHNGAGKSTTIKMITGDTKPTAGQVILKGSGGGEPLGFLGYCPQENALWPNLTVR
QHLEVYAAVKGLRKGDAMIAITRLVDALKLQDQLKAPVKTLSEGIKRKLCFVLSILGNPS
VVLLDEPSTGMDPEGQQQMWQVIRATFRNTERGALLTTHYMAEAEAVCDRVAIMVSGRLR
CIGSIQHLKSKFGKDYLLEMKLKNLAQMEPLHAEILRLFPQAAQQERFSSLMVYKLPVED
VRPLSQAFFKLEIVKQSFDLEEYSLSQSTLEQVFLELSKEQELGDLEEDFDPSVKWKLLL
QEEP
NT seq 4875 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagagacgcatgagcgtgggtcagcaaacatgggctcttctctgcaagaactgt
ctcaaaaaatggagaatgaaaagacagaccttgttggaatggctcttttcatttcttctg
gtactgtttctgtacctatttttctccaatttacatcaagttcatgacactcctcaaatg
tcttcaatggatctgggacgtgtagatagttttaatgatactaattatgttattgcattt
gcacctgaatccaaaactacccaagagataatgaacaaagtggcttcagccccattccta
aaaggaagaacaatcatggggtggcctgatgaaaaaagcatggatgaattggatttgaac
tattcaatagacgcagtgagagtcatctttactgataccttctcctaccatttgaagttt
tcttggggacatagaatccccatgatgaaagagcacagagaccattcagctcactgtcaa
gcagtgaatgaaaaaatgaagtgtgaaggttcagagttctgggagaaaggctttgtagct
tttcaagctgccattaatgctgctatcatagaaatcgcaacaaatcattcagtgatggaa
cagctgatgtcagttactggtgtacatatgaagatattaccttttgttgcccaaggagga
gttgcaactgattttttcattttcttttgcattatttctttttctacatttatatactat
gtatcagtcaatgttacacaagaaagacaatacattacgtcattgatgacaatgatggga
ctccgagagtcagcattctggctttcctggggtttgatgtatgctggcttcatccttatc
atggccactttaatggctcttattgtaaaatctgcacaaattgtcgtcctgactggtttt
gtgatggtcttcaccctctttctcctctatggcctgtctttgataactttagctttcctg
atgagtgtgttgataaagaaacctttccttacgggcttggttgtgtttctccttattgtc
ttttgggggatcctgggattcccagcattgtatacacgtcttcctgcatttttggaatgg
actttgtgtcttcttagcccctttgccttcactgttgggatggcccagcttatacatttg
gactatgatgtgaattctaatgcccacttggattcttcacaaaatccatacctcataata
gctactcttttcatgttggtttttgacacccttctgtatttggtattgacattatatttt
gacaaaattttgcccgctgaatatggacatcgatgttctcccttgtttttcctgaaatcc
tgtttttggtttcaacacggaagggctaatcatgtggtccttgagaatgaaacagattct
gatcctacacctaatgactgttttgaaccagtgtctccagaattctgtgggaaagaagcc
atcagaatcaaaaatcttaaaaaagaatatgcagggaagtgtgagagagtagaagctttg
aaaggtgtggtgtttgacatatatgaaggccagatcactgccctccttggtcacagtgga
gctggaaaaactaccctgttaaacatacttagtgggttgtcagttccaacatcaggttca
gtcactgtctataatcacacactttcaagaatggctgatatagaaaatatcagcaagttc
actggattttgtccacaatccaatgtgcaatttggatttctcactgtgaaagaaaacctc
aggctgtttgctaaaataaaagggattttgccacatgaagtggagaaagaggtacaacga
gttgtacaggaattagaaatggaaaatattcaagacatccttgctcaaaacttaagtggt
ggacaaaataggaaactaacttttgggattgccattttaggagatcctcaagttttgcta
ttggatgaaccgactgctggattggatcctctttcaaggcaccgaatatggaatctcctg
aaagaggggaaatcagacagagtaattctcttcagcacccagtttatagatgaggctgac
attctggcggacaggaaggtgttcatatccaatgggaagctgaagtgtgcaggctcttct
ctgttccttaagaagaaatggggcataggctaccatttaagtttgcatctgaatgaaagg
tgtgatccagagagtataacatcactggttaagcagcacatctctgatgccaaattgaca
gcacaaagtgaagaaaaacttgtatatattttgcctttggaaaggacaaacaaatttcca
gaactttacagggatcttgatagatgttctaaccaaggcattgaggattatggtgtttcc
ataacaactttgaatgaggtgtttctgaaattagaaggaaaatcaactattgatgaatca
gatattggaatttggggacaattacaaactgatggggcaaaagatataggaagccttgtt
gagctggaacaagttttgtcttccttccacgaaacaaggaaaacaatcagtggcgtggcg
ctctggaggcagcaggtctgtgcaatagcaaaagttcgcttcctaaagttaaagaaagaa
agaaaaagcctgtggactatattattgctttttggtattagctttatccctcaacttttg
gaacatctattctacgagtcatatcagaaaagttacccgtgggaactgtctccaaataca
tacttcctctcaccaggacaacaaccacaggatcctctgacccatttactggtcatcaat
aagacagggtcaaccattgataactttttacattcactgaggcgacagaacatagctata
gaagtggatgcctttggaactagaaatggcacagatgacccatcttacaatggtgctatc
attgtgtcaggtgatgaaaaggatcacagattttcaatagcatgtaatacaaaacggctg
aattgctttcctgtcctcctggatgtcattagcaatggactacttggaatttttaattcg
tcagaacacattcagactgacagaagcacattttttgaagagcatatggattatgagtat
gggtaccgaagtaacaccttcttctggataccgatggcagcctctttcactccatacatt
gcaatgagcagcattggtgactacaaaaaaaaagctcattcccagctacggatttcaggc
ctctacccttctgcatactggtttggccaagcactggtggatgtttccctgtactttttg
atcctcctgctaatgcaaataatggattatatttttagcccagaggagattatatttata
attcaaaacctgttaattcaaatcctgtgtagtattggctatgtctcatctcttgttttc
ttgacatatgtgatttcattcatttttcgcaatgggagaaaaaatagtggcatttggtca
tttttcttcttaattgtggtcatcttctcgatagttgctactgatctaaatgaatatgga
tttctagggctattttttggcaccatgttaatacctcccttcacattgattggctctcta
ttcattttttctgagatttctcctgattccatggattacttaggagcttcagaatctgaa
attgtatacctggcactgctaataccttaccttcattttctcatttttcttttcattctg
cgatgcctagaaatgaactgcaggaagaaactaatgagaaaggatcctgtgttcagaatt
tctccaagaagcaacgctatttttccaaacccagaagagcctgaaggagaggaggaagat
atccagatggaaagaatgagaacagtgaatgctatggctgtgcgagactttgatgagaca
cccgtcatcattgccagctgtctacggaaggaatatgcaggcaaaaagaaaaattgcttt
tctaaaaggaagaaaaaaattgccacaagaaatgtctctttttgtgttaaaaaaggtgaa
gttataggactgttaggacacaatggagctggtaaaagtacaactattaagatgataact
ggagacacaaaaccaactgcaggacaggtgattttgaaagggagcggtggaggggaaccc
ctgggcttcctggggtactgccctcaggagaatgcgctgtggcccaacctgacagtgagg
cagcacctggaggtgtacgctgccgtgaaaggtctcaggaaaggggacgcaatgatcgcc
atcacacggttagtggatgcgctcaagctgcaggaccagctgaaggctcccgtgaagacc
ttgtcagagggaataaagcgaaagctgtgctttgtgctgagcatcctggggaacccgtca
gtggtgcttctggatgagccgtcgaccgggatggaccccgaggggcagcagcaaatgtgg
caggtgattcgggccacctttagaaacacggagaggggcgccctcctgaccacccactac
atggcagaggctgaggcggtgtgtgaccgagtggccatcatggtgtcaggaaggctgaga
tgtattggttccatccaacacctgaaaagcaaatttggcaaagactacctgctggagatg
aagctgaagaacctggcacaaatggagcccctccatgcagagatcctgaggcttttcccc
caggctgctcagcaggaaaggttctcctccctgatggtctataagttgcctgttgaggat
gtgcgacctttatcacaggctttcttcaaattagagatagttaaacagagtttcgacctg
gaggagtacagcctctcacagtctaccctggagcaggttttcctggagctctccaaggag
caggagctgggtgatcttgaagaggactttgatccctcggtgaagtggaaactcctcctg
caggaagagccttaa

DBGET integrated database retrieval system