KEGG   Homo sapiens (human): 10368Help
Entry
10368             CDS       T01001                                 

Gene name
CACNG3
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 3
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04921  Oxytocin signaling pathway
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    10368 (CACNG3)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    10368 (CACNG3)
  Circulatory system
   04260 Cardiac muscle contraction
    10368 (CACNG3)
   04261 Adrenergic signaling in cardiomyocytes
    10368 (CACNG3)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    10368 (CACNG3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    10368 (CACNG3)
   05414 Dilated cardiomyopathy (DCM)
    10368 (CACNG3)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN gamma
   10368 (CACNG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 ABC2_membrane_2
Motif
Other DBs
NCBI-GeneID: 10368
NCBI-ProteinID: NP_006530
OMIM: 606403
HGNC: 1407
Ensembl: ENSG00000006116
Vega: OTTHUMG00000131651
Pharos: O60359(Tbio)
UniProt: O60359
Position
16p12.1
AA seq 315 aa AA seqDB search
MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTH
SGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGL
CVAASEFHRSRHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFY
FGAFSFIIAEIVGVVAVHIYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRST
EPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPKEFK
ESLHNNPANRRTTPV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgtgtgacagaggtatccagatgttgatcaccactgtaggagcctttgccgct
tttagtttaatgaccattgcagtgggcacggactactggttatattccagaggtgtgtgc
aggactaaatctacaagtgataatgaaaccagcaggaagaatgaagaagtaatgacccat
tcggggctgtggaggacctgctgcctagaaggggctttccgaggcgtgtgcaagaaaatc
gatcacttccctgaagatgctgactacgaacaggacacagccgaatatctcctgcgagct
gtgagggcctccagtgtcttccccatcctcagtgtcacgctgctgttcttcggcgggctc
tgcgtggcagccagtgagttccaccgcagcagacacaacgtcattctcagcgcgggcatc
ttttttgtctctgcagggttaagcaacatcattggcatcatagtttatatatcagccaac
gccggagaccccgggcagcgtgactccaaaaaaagttactcctatggttggtccttttat
ttcggagccttctctttcatcatcgcagaaattgtaggagtggttgccgtgcacatctat
attgaaaaacatcagcagttacgagccaaatcccactcggagttcctgaagaaatctact
tttgcccgcctcccaccctacaggtatcgattccggaggcggtcaagttctcgctccacc
gagcccagatcccgagacctgtcccccatcagcaaaggcttccacaccatcccttccact
gacatctcgatgttcaccctctcccgggacccctcaaagatcaccatggggaccctcctc
aactccgaccgggaccacgcttttctacagttccacaattccacacccaaagagttcaaa
gagtcactgcataataatccggccaacaggcgcaccacgcccgtctga

DBGET integrated database retrieval system