KEGG   Homo sapiens (human): 10370Help
Entry
10370             CDS       T01001                                 

Gene name
CITED2, ASD8, MRG-1, MRG1, P35SRJ, VSD2
Definition
(RefSeq) Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q23.3
AA seq 270 aa AA seqDB search
MADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNALMGEHIHYGA
GNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVASQGGSLPASMQLQKLN
NQYFNHHPYPHNHYMPDLHPAAGHQMNGTNQHFRDCNPKHSGGSSTPGGSGGSSTPGGSG
SSSGGGAGSSNSGGGSGSGNMPASVAHVPAAMLPPNVIDTDFIDEEVLMSLVIEMGLDRI
KELPELWLGQNEFDFMTDFVCKQQPSRVSC
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcagaccatatgatggccatgaaccacgggcgcttccccgacggcaccaatgggctg
caccatcaccctgcccaccgcatgggcatggggcagttcccgagcccccatcaccaccag
cagcagcagccccagcacgccttcaacgccctaatgggcgagcacatacactacggcgcg
ggcaacatgaatgccacgagcggcatcaggcatgcgatggggccggggactgtgaacgga
gggcaccccccgagcgcgctggcccccgcggccaggtttaacaactcccagttcatgggt
cccccggtggccagccagggaggctccctgccggccagcatgcagctgcagaagctcaac
aaccagtatttcaaccatcacccctacccccacaaccactacatgccggatttgcaccct
gctgcaggccaccagatgaacgggacaaaccagcacttccgagattgcaaccccaagcac
agcggcggcagcagcacccccggcggctcgggcggcagcagcacccccggcggctctggc
agcagctcgggcggcggcgcgggcagcagcaacagcggcggcggcagcggcagcggcaac
atgcccgcctccgtggcccacgtccccgctgcaatgctgccgcccaatgtcatagacact
gatttcatcgacgaggaagttcttatgtccttggtgatagaaatgggtttggaccgcatc
aaggagctgcccgaactctggctggggcaaaacgagtttgattttatgacggacttcgtg
tgcaaacagcagcccagcagagtgagctgttga

DBGET integrated database retrieval system