KEGG   Homo sapiens (human): 10379Help
Entry
10379             CDS       T01001                                 

Gene name
IRF9, IRF-9, ISGF3, ISGF3G, p48
Definition
interferon regulatory factor 9
Orthology
K04693  
interferon regulatory factor 9
Organism
hsa  Homo sapiens (human)
Pathway
Osteoclast differentiation
Jak-STAT signaling pathway
Hepatitis C
Measles
Influenza A
Herpes simplex infection
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q11.2
AA seq 393 aa AA seqDB search
MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFK
AWAIFKGKYKEGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIV
SGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIG
SSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLD
CRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISW
NAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLNFWEESHGSSH
TPQNLITVKMEQAFARYLLEQTPEQQAAILSLV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaggcagggcacgctgcacccgaaaactccggaactgggtggtggagcaagtg
gagagtgggcagtttcccggagtgtgctgggatgatacagctaagaccatgttccggatt
ccctggaaacatgcaggcaagcaggacttccgggaggaccaggatgctgccttcttcaag
gcctgggcaatatttaagggaaagtataaggagggggacacaggaggtccagctgtctgg
aagactcgcctgcgctgtgcactcaacaagagttctgaatttaaggaggttcctgagagg
ggccgcatggatgttgctgagccctacaaggtgtatcagttgctgccaccaggaatcgtc
tctggccagccagggactcagaaagtaccatcaaagcgacagcacagttctgtgtcctct
gagaggaaggaggaagaggatgccatgcagaactgcacactcagtccctctgtgctccag
gactccctcaataatgaggaggagggggccagtgggggagcagtccattcagacattggg
agcagcagcagcagcagcagccctgagccacaggaagttacagacacaactgaggccccc
tttcaaggggatcagaggtccctggagtttctgcttcctccagagccagactactcactg
ctgctcaccttcatctacaacgggcgcgtggtgggcgaggcccaggtgcaaagcctggat
tgccgccttgtggctgagccctcaggctctgagagcagcatggagcaggtgctgttcccc
aagcctggcccactggagcccacgcagcgcctgctgagccagcttgagaggggcatccta
gtggccagcaacccccgaggcctcttcgtgcagcgcctttgccccatccccatctcctgg
aatgcaccccaggctccacctgggccaggcccgcatctgctgcccagcaacgagtgcgtg
gagctcttcagaaccgcctacttctgcagagacttggtcaggtactttcagggcctgggc
cccccaccgaagttccaggtaacactgaatttctgggaagagagccatggctccagccat
actccacagaatcttatcacagtgaagatggagcaggcctttgcccgatacttgctggag
cagactccagagcagcaggcagccattctgtccctggtgtag

DBGET integrated database retrieval system