KEGG   Homo sapiens (human): 10379Help
Entry
10379             CDS       T01001                                 

Gene name
IRF9, IRF-9, ISGF3, ISGF3G, p48
Definition
(RefSeq) interferon regulatory factor 9
  KO
K04693  
interferon regulatory factor 9
Organism
hsa  Homo sapiens (human)
Pathway
Necroptosis
Osteoclast differentiation
NOD-like receptor signaling pathway
Jak-STAT signaling pathway
Hepatitis C
Measles
Influenza A
Human papillomavirus infection
Kaposi's sarcoma-associated herpesvirus infection
Herpes simplex infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    10379 (IRF9)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    10379 (IRF9)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    10379 (IRF9)
  Development
   04380 Osteoclast differentiation
    10379 (IRF9)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    10379 (IRF9)
  Infectious diseases
   05162 Measles
    10379 (IRF9)
   05164 Influenza A
    10379 (IRF9)
   05160 Hepatitis C
    10379 (IRF9)
   05168 Herpes simplex infection
    10379 (IRF9)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    10379 (IRF9)
   05165 Human papillomavirus infection
    10379 (IRF9)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    10379 (IRF9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q00978(Tbio)
UniProt: 
Position
14q12
AA seq 393 aa AA seqDB search
MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFK
AWAIFKGKYKEGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIV
SGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIG
SSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLD
CRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISW
NAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLNFWEESHGSSH
TPQNLITVKMEQAFARYLLEQTPEQQAAILSLV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaggcagggcacgctgcacccgaaaactccggaactgggtggtggagcaagtg
gagagtgggcagtttcccggagtgtgctgggatgatacagctaagaccatgttccggatt
ccctggaaacatgcaggcaagcaggacttccgggaggaccaggatgctgccttcttcaag
gcctgggcaatatttaagggaaagtataaggagggggacacaggaggtccagctgtctgg
aagactcgcctgcgctgtgcactcaacaagagttctgaatttaaggaggttcctgagagg
ggccgcatggatgttgctgagccctacaaggtgtatcagttgctgccaccaggaatcgtc
tctggccagccagggactcagaaagtaccatcaaagcgacagcacagttctgtgtcctct
gagaggaaggaggaagaggatgccatgcagaactgcacactcagtccctctgtgctccag
gactccctcaataatgaggaggagggggccagtgggggagcagtccattcagacattggg
agcagcagcagcagcagcagccctgagccacaggaagttacagacacaactgaggccccc
tttcaaggggatcagaggtccctggagtttctgcttcctccagagccagactactcactg
ctgctcaccttcatctacaacgggcgcgtggtgggcgaggcccaggtgcaaagcctggat
tgccgccttgtggctgagccctcaggctctgagagcagcatggagcaggtgctgttcccc
aagcctggcccactggagcccacgcagcgcctgctgagccagcttgagaggggcatccta
gtggccagcaacccccgaggcctcttcgtgcagcgcctttgccccatccccatctcctgg
aatgcaccccaggctccacctgggccaggcccgcatctgctgcccagcaacgagtgcgtg
gagctcttcagaaccgcctacttctgcagagacttggtcaggtactttcagggcctgggc
cccccaccgaagttccaggtaacactgaatttctgggaagagagccatggctccagccat
actccacagaatcttatcacagtgaagatggagcaggcctttgcccgatacttgctggag
cagactccagagcagcaggcagccattctgtccctggtgtag

DBGET integrated database retrieval system