KEGG   Homo sapiens (human): 1038Help
Entry
1038              CDS       T01001                                 

Gene name
CDR1, CDR, CDR34, CDR62A
Definition
(RefSeq) cerebellar degeneration related protein 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
Xq27.1
AA seq 262 aa AA seqDB search
MAWLEDVDFLEDVPLLEDIPLLEDVPLLEDVPLLEDTSRLEDINLMEDMALLEDVDLLED
TDFLEDLDFSEAMDLREDKDFLEDMDSLEDMALLEDVDLLEDTDFLEDPDFLEAIDLRED
KDFLEDMDSLEDLEAIGRCGFSGRHGFFGRRRFSGRPKLSGRLGLLGRRGFSGRLGGYWK
TWIFWKTWIFWKTWIFRKTYIGWKTWIFSGRCGLTGRPGFGGRRRFFWKTLTDWKTWISF
WKTLIDWKTWISFWKTLIDWKI
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggcttggttggaagacgtggattttctggaagacgtacctttgttggaagacatacct
ttgttggaagacgtacctttgttggaagacgtacctttgttggaagacacaagtaggctg
gaagacattaatttgatggaagacatggctttgttggaagacgtggatttgctggaagac
acggatttcctggaagacctggatttttcggaagctatggatttgagggaagacaaggat
tttctggaagacatggatagtctggaagacatggctttgttggaagacgtggacttgctg
gaagacacggatttcctggaagacccggattttttggaagctatagatttaagggaagac
aaggattttctggaagacatggatagtctggaagacctggaggccattggaagatgtgga
ttttctggaagacatggcttttttggaagacgtagattttcaggaagacccaaattatcc
ggaagacttggattgttgggaagacgtggattttctggaagactgggaggttactggaag
acatggattttctggaagacatggattttctggaagacgtggatcttcaggaagacatat
attggctggaagacctggattttttccggaagatgtggattgactggaagacctggattt
ggtggaagacgtagatttttctggaagacactgactgactggaagacctggatttctttc
tggaagacactgattgactggaagacctggatttctttctggaagacactgattgactgg
aagatctag

DBGET integrated database retrieval system